KEGG   Mesorhizobium australicum: Mesau_02468
Entry
Mesau_02468       CDS       T02417                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
mam  Mesorhizobium australicum
Pathway
mam00230  Purine metabolism
mam01100  Metabolic pathways
mam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mesau_02468
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Mesau_02468
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGB44892
UniProt: L0KHU8
Position
2530056..2532362
AA seq 768 aa
MNVTAPIGEREFKIVGKSVKRDDVLEKVTGEAEYTGDVKLPGMLHGKIKRAAIAHARIKS
IDVSKALAYPGVKAVLTHENVPRVLHYGSPHPRSASCTKDQYILDDKVRFWGEGVAAVAA
ISEEIADEALDLIEVEYEPLPAVFEPEDAAQPGAPLIHNVGPGGNLVLDPVRVNRGNIDA
GFAQADFVLEGTFSGGRPHPAYMEPNVCIADWDGSNKLTFWTSTQTAFMVRGILAEVLGL
PLTKVRVLVDHMGGGFGAKQDCFQHEFLCALLAKETRRPVKMEFTRHETFVAGRSRHPCR
VWLKQGFKNDGTLVARDMKLVYDSGAYGSHGPGVTIVGTNAATSLYRCENVRLEGRCVYT
NTPINGAFRGYGVVQSYYALDIQMDEAAERLGMDPAELKLKNVVRAGDIAPSGHPILGHG
LEICLQHGIDVLDWKKLRNRDRTPDPKHPHISKGWGIGCEMHGSSAYPGIKEQGNATVKV
NEDGTVTLLTGAAGLGTGAHTALAQIVAEELGVRFEEVGIIHGDTDVVPWDIGAFASHTT
YLVGTAAKMAATKVRGAVLERAAMKLQVTPGEIDLSEGRIFVTAEPGRFMTVAEAMGPSR
GIPATNIVANGTYEPTKSYSFAAHFTEVDVDTETGIVEVKRVIPVHDIGRVIHPIAAQGQ
IEGGIQQGIGHTLTEDYIIDKKTGRSLNAGLVDYKMPLSMDMPDIETIILEAAPDPGGPW
GAKGVGEDPIIAIGPAIANAIHDAIGVRFHHYPITPEDILKALREKGA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgaacgtgacggcccctatcggagagcgggaattcaagatcgtcggcaagagcgtcaaa
cgcgacgacgtgttggaaaaagtgacgggcgaggccgaatataccggcgacgtcaaattg
ccaggcatgctgcacggcaagatcaagcgcgccgccattgcgcacgcccgcatcaagagc
atcgatgtcagcaaggcgctcgcctatccgggcgtgaaggctgtgctgacccatgaaaac
gtgccgcgcgtgctgcattacggctcaccgcatccgcgctcggcctcttgcaccaaggac
cagtatatcctcgacgacaaggtgcggttctggggtgagggcgtcgccgccgttgcggcc
atcagcgaagagatcgccgacgaggcgctcgatctgatcgaggtcgaatacgagcccttg
ccggccgtcttcgagccggaagacgcagcccagcccggcgcgccgctgatccacaatgtc
ggtcctggcggcaacctggtactcgatccggtgcgcgtcaatcgcgggaatatcgacgct
ggttttgcccaggcggatttcgtacttgaaggcaccttctccggcgggcggccgcatccg
gcctatatggagccgaatgtctgcatcgccgactgggacggctccaacaagctgactttc
tggacctcgacgcagaccgccttcatggtgcgcggcatcctggccgaagtgctcggcctg
ccactcaccaaggtgcgcgttctcgtcgaccacatgggcggcggcttcggcgccaagcag
gactgtttccagcacgaattcctttgcgcactactcgcaaaggaaacgcgccggcccgtg
aagatggaattcacccgccacgagaccttcgtcgccggccgttcgcgccacccctgcagg
gtctggttgaagcagggcttcaagaatgacggcacgctcgtggcgcgtgacatgaagctt
gtctatgactccggcgcttacggctcgcatggcccgggcgtgaccatcgtcggcaccaat
gccgcgacctcgctctatcgctgcgagaacgttcggctagaaggtcgctgcgtctacacc
aatacgccgatcaacggcgccttccgcggctacggcgtggtgcagagctactatgcgctc
gacatccagatggacgaggcggctgaaaggctcggcatggacccggcggaactgaagctg
aagaacgtggtgcgcgcgggcgatatcgccccgtccggtcacccgatcctcggccacggc
ctggaaatctgccttcagcacggcatcgatgtgctcgactggaagaagctgcgcaaccgt
gaccgcacgccggacccgaagcacccccatatcagcaagggctggggcatcggctgcgaa
atgcatggttcttcagcctatccgggcatcaaggaacagggcaacgcgaccgtgaaggtc
aacgaggacggcacggtgacgctgctcaccggcgctgccggtctcggcaccggcgcgcat
acggcgctggcacagatcgttgccgaagaactcggcgtgcgcttcgaagaggtcggcatc
atccatggcgatacggatgtcgtgccgtgggacatcggcgccttcgccagccacacgacc
tatctggtcggcaccgctgccaagatggcggccaccaaggtgcgcggggccgttctcgag
cgggctgcgatgaagctgcaagtcacgcccggcgagatcgacctttccgaaggccggatc
ttcgtcacggccgagccgggccgcttcatgacggttgccgaggcgatgggtccctcgcgc
ggtatcccggccaccaacatcgtggccaatggcacctacgagccgacgaaatcctattcc
ttcgccgcgcatttcacagaagtggacgtggatacggaaacgggcatcgtcgaggtcaaa
cgggttatcccggtgcacgatatcggccgggtcatccacccgattgcggcgcagggccag
atcgagggcggcatccagcaaggcatcggccacacgctgaccgaggactacatcatcgac
aagaagaccggccggtcgctgaacgccggcctcgtcgactacaagatgccgctctccatg
gacatgcccgatatcgagacgatcatcctcgaagccgcgcccgatccgggcggcccatgg
ggcgccaagggcgtcggcgaagacccgatcatcgccatcggccccgccatcgccaatgcc
atccacgacgccatcggcgtccgcttccatcactatccgatcacccccgaagacatcctg
aaagccttgagggagaagggcgcatga

DBGET integrated database retrieval system