KEGG   Mesorhizobium australicum: Mesau_02694Help
Entry
Mesau_02694       CDS       T02417                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mam  Mesorhizobium australicum
Pathway
mam00520  Amino sugar and nucleotide sugar metabolism
mam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_02694
Enzymes [BR:mam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Mesau_02694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: AGB45108
UniProt: L0KLY7
Position
2766719..2767693
Genome map
AA seq 324 aa AA seqDB search
MQQAKQILVTGGAGFLGSFLCERLLAEGHQVVCADNFFTGSRRNVSHLLDDRSFEIIRHD
VTFPLYVEVDEIYNLACPASPVHYQSDPVQTTKTSVHGAINMLGLAKRVRAHILQASTSE
VYGDPEVHPQLEDYWGRVNPIGPRSCYDEGKRCAETLFFDYWRQHKLKIKVARIFNTYGP
RMRPDDGRVVSNFIVQALQNKPITVYGTGQQTRSFCYVEDLIDGLVRLMQTADDITGPVN
LGNPAEFTMLELANLVIELTGSRSKIRFSPLPVDDPKQRQPDIRYASRELKWKPRTALRA
GLAKTIAYFEDVVSSGHIRPAAAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgaaacaaatcttggtgacaggcggcgcaggtttcctgggatcatttttg
tgcgagcggctccttgctgagggccatcaggtagtttgcgcagataacttcttcacagga
agccgcagaaacgtctctcatctcctcgatgaccgatcgttcgagattattcgtcatgac
gtgacgtttccactctacgtagaggttgacgaaatatacaatctcgcctgtccggcgagc
cccgtccactatcagtccgaccccgtccagacgaccaaaaccagcgttcatggcgcgatc
aatatgctcggactggccaagcgggttcgcgcacacattctgcaggcgtccacctccgaa
gtctatggcgacccggaggttcatccgcagttggaagactattggggcagagtgaacccg
attggccctcgttcctgctatgacgaaggcaagcgatgtgccgagaccctgtttttcgac
tattggcgacagcacaagctgaagatcaaggtagcccgtattttcaatacctacggtcca
aggatgcgtcccgacgacggtcgtgtcgtttccaatttcatcgtgcaggcgctgcaaaac
aaaccgattacggtctacggcactggccagcagacgcgttcattctgctacgtcgaggac
ctcatcgacggtctggtacgtcttatgcagacggccgacgatatcaccggtcctgtcaat
ctcggcaacccggcggaattcacgatgctcgaactcgcaaatctggtgatcgaacttacc
ggaagccgatcgaagatcagattttcgccgctaccggtcgacgatccaaagcagcggcag
cccgatatccgatatgcttcccgcgaactcaaatggaagccaagaactgcattgcgtgct
ggccttgccaagacaattgcgtatttcgaggacgtggtttcatctgggcacattcggccc
gccgcagccgaatga

DBGET integrated database retrieval system