KEGG   Mesorhizobium australicum: Mesau_02979Help
Entry
Mesau_02979       CDS       T02417                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mam  Mesorhizobium australicum
Pathway
mam00010  Glycolysis / Gluconeogenesis
mam00053  Ascorbate and aldarate metabolism
mam00071  Fatty acid degradation
mam00280  Valine, leucine and isoleucine degradation
mam00310  Lysine degradation
mam00330  Arginine and proline metabolism
mam00340  Histidine metabolism
mam00380  Tryptophan metabolism
mam00410  beta-Alanine metabolism
mam00561  Glycerolipid metabolism
mam00620  Pyruvate metabolism
mam00625  Chloroalkane and chloroalkene degradation
mam00903  Limonene and pinene degradation
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
Module
mam_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_02979
   00053 Ascorbate and aldarate metabolism
    Mesau_02979
   00620 Pyruvate metabolism
    Mesau_02979
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mesau_02979
   00561 Glycerolipid metabolism
    Mesau_02979
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesau_02979
   00310 Lysine degradation
    Mesau_02979
   00330 Arginine and proline metabolism
    Mesau_02979
   00340 Histidine metabolism
    Mesau_02979
   00380 Tryptophan metabolism
    Mesau_02979
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesau_02979
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesau_02979
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mesau_02979
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Mesau_02979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGB45360
UniProt: L0KL40
Position
3043733..3045166
Genome map
AA seq 477 aa AA seqDB search
MSHDLQFYIDGAWVDPVVPDTLDVIDPSNEDAFARISLGSRADVDKAVAAAKRAFNTYGF
TSVEERLDILNRVIEVYKKRSKDLAVAVSREMGAPRQMALDSQVGIGLAHLAKMAETLKN
FQFRHVKGNHLVVKEPIGVVGLITPWNWPLNQITCKVGPALAAGCTMVLKPSEIAPLDAI
IFAEIIDEAGVPKGVFNLVNGDGPGVGQALSSHPDIDMMSFTGSTRAGILVAKAAADTVK
RVHQELGGKSANILFPDVDLATAVSKGVAGCFSNSGQSCNAPTRMFVPRDRHDEAAGYAR
TAAEKFTVGPADGANTKLGPVVSQVQFDKIQDLIQSGMDEGATLVAGGPGRPAELNRGYY
VRPTVFADVTHDMRIAREEVFGPVLAILPYDTVEQAVEQANDTVYGLASYIQAKDLQKAR
EVAARMRSGNVYINYPQWDAGLPFGGYKQSGNGREYAEYGLEDFLEIKGIAGYEAAE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgatctgcagttctacatcgatggcgcgtgggtcgatcctgtcgtgcccgac
acgctcgacgtaatcgatccatcgaacgaggacgctttcgcgcggatttcgctcggctcc
agggccgatgtcgataaggcggtggccgccgccaagcgcgccttcaacacatatggcttc
acctcggtcgaggagcgcctcgacatcctcaaccgcgtcatcgaggtctacaagaagcgc
agcaaggacctggcggtcgccgtgtcgcgcgagatgggcgcgccgcgccagatggcgctc
gacagccaggtcggcatcggcctggcgcatctggccaaaatggccgagacgctgaagaat
ttccagttccgccacgtcaagggcaaccatctcgtggtcaaggagccgatcggcgtcgtc
ggcctgatcacgccctggaactggccgctgaaccagatcacctgcaaggtcggtccggca
ctcgccgccggctgcaccatggtgctgaagccgtcggaaatcgcgccgctcgatgccatc
atcttcgccgagatcatcgacgaggccggcgtgccgaagggcgtgttcaacctcgtcaat
ggcgacggccctggcgtcggccaggcgctgtccagccatcccgacatcgacatgatgtcg
ttcaccggttcgacgcgagccggcatattggtggccaaggccgccgctgacaccgtcaag
cgcgtgcatcaggagcttggcggcaagtcggccaacatcctgttcccggatgtcgacctc
gccaccgccgtcagcaagggcgtcgccggctgcttcagcaacagcggccagtcctgcaac
gcgccgacgcgcatgttcgtgccgcgcgaccgccacgacgaggccgcgggatatgccagg
acggcggcggaaaagttcacggtcggtccagccgacggcgccaacaccaagctcggcccc
gtcgtcagccaggtccagttcgataagatccaggacctgatccagagcggcatggacgag
ggtgccacgctggtcgccggcggccccggccgccctgccgaactcaatcgcggctactat
gtcaggccgaccgtgttcgccgacgtcacccacgacatgcgcatcgcgcgcgaggaggtt
ttcgggccggtgttggcgatcctgccctacgacacggtcgagcaggctgtcgagcaggcc
aacgacaccgtctatggccttgcctcctacatccaggccaaggacctacagaaggcgcgc
gaggtcgcggcccgcatgcgctcgggcaatgtctacatcaactatccccaatgggacgcc
ggcctgcccttcggcggctacaagcagtcgggcaacggccgcgaatacgccgaatacggg
ctcgaggatttcctcgagatcaagggcatcgcggggtacgaggcggcggagtag

DBGET integrated database retrieval system