KEGG   Mesorhizobium australicum: Mesau_03191Help
Entry
Mesau_03191       CDS       T02417                                 

Definition
(GenBank) esterase/lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mam  Mesorhizobium australicum
Pathway
mam00903  Limonene and pinene degradation
mam00930  Caprolactam degradation
mam01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesau_03191
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mesau_03191
Enzymes [BR:mam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Mesau_03191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 DLH
Motif
Other DBs
NCBI-ProteinID: AGB45563
UniProt: L0KN87
Position
3244411..3245349
Genome map
AA seq 312 aa AA seqDB search
MASMQSQANRNHYAALAANAGKLTSPQAVIDYNDVNWTALTGEPGGVDYIEVDAGGVPAM
WIVPKGADEQRVLFYAHGGGFIGGSIYTHRKLVGHLAKAIGCRALLYDYPLAHQAKHPAQ
IEAATSAWDWLVDQGFDPKRIVIAGDSCGAVPTYGVLQRLRAQRRPLPVATLIISGWFDM
ALTGASYETNRDKDPAFAREAVDWLAANFIGDADRRDPEVSPLYADLSGFPPVFLQVGAD
ETLVDESRMFAERARQAGVETRLDVFDGMLHSFQMMAGRAPEADDAIARFAAWVRPRLGL
PAPGEKTSEKAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcatgcaaagtcaggcaaacaggaaccactacgccgcgctcgcggccaatgcg
ggcaagttgaccagcccgcaggcggtcatcgactacaacgacgtcaattggacggcgctg
accggcgaaccgggcggcgtcgattatatcgaggtcgatgccggcggcgtgccggcgatg
tggatcgtgccgaagggcgccgacgagcagcgggtgctgttttacgcgcatggcggcggc
ttcatcggcggctcgatctacacgcaccgcaagctggtcggtcatctcgccaaggccatc
ggctgccgggcgctgctctacgactatccgctggcgcatcaagcgaagcatccggcccag
atcgaggccgcgacatcggcctgggactggctcgtcgaccaaggcttcgaccccaagcgg
atcgtgatcgcaggcgactcctgcggcgcggtgccgacctatggcgtcctgcagcggctg
cgcgcgcaaaggcggccgctgccggtcgccacgctgatcatctccggctggttcgacatg
gcgttgaccggcgccagctacgagaccaaccgcgacaaggacccggccttcgctagggaa
gccgtcgactggctggcggccaatttcatcggcgatgccgatcggcgcgatcccgaagtc
agcccgctctacgccgacctctccggctttccgcccgtcttcctgcaagtcggcgccgac
gagacgctggtcgacgaaagccggatgttcgccgagcgggcgaggcaggcgggcgtcgag
acgcggctcgacgtctttgacggcatgctccactccttccagatgatggcagggcgggcg
ccggaggccgatgacgccattgcccgcttcgccgcctgggtgcggccgagactggggctg
ccggctcccggtgagaagaccagcgaaaaggcggcgtga

DBGET integrated database retrieval system