KEGG   Mesorhizobium australicum: Mesau_03385Help
Entry
Mesau_03385       CDS       T02417                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
mam  Mesorhizobium australicum
Brite
KEGG Orthology (KO) [BR:mam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mesau_03385
Enzymes [BR:mam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Mesau_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 PCMT FtsJ MTS Methyltransf_32 CheR RrnaAD CMAS
Motif
Other DBs
NCBI-ProteinID: AGB45752
UniProt: L0KK81
Position
3438223..3439008
Genome map
AA seq 261 aa AA seqDB search
MTTNEGRDWSAAQYLKFEDERTRPARDLVAQVPVDFPRRVVDIGCGPGNSTELLVERWLD
AQVSGFDTSPDMIEKARTRLPNVSFDLADASTWQPAEPVNVIFANAVFQWLPEHPAVFQR
LMGFLAPGGALAVQMPDNMAEDSHRLMRETAAEAPFAAKIRDAARAPLPPVSFYYDLLSP
LSARLDIWHTIYNHPLADADAIVEWVKSTGLKPFLDPLDADERKLFLDSYTAKVAKAYPK
TADGKVLLRFPRIFIVAKGAG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaacgaaggtagggattggtccgccgcccaatatctgaaattcgaggacgag
cgcacgcgcccggcgcgtgacctcgtggcgcaagtgccggtcgactttccgcgccgggta
gtcgatatcggctgcgggccgggcaattcgaccgaacttctggtcgagcgctggctggat
gcgcaagtgagcggcttcgacacctctcccgacatgatcgagaaggcgaggacgcggctg
cccaatgtcagcttcgacctcgccgatgcgtcgacttggcagccggccgagccggtcaac
gtgatcttcgccaacgccgtcttccagtggctgccggagcatccggcggtgttccagcgc
ctgatgggttttctggcccccggcggcgcgctggccgtccagatgcccgacaatatggcc
gaggattctcatcgcctgatgcgggagaccgccgccgaagcgcctttcgcggcaaagatc
agggatgcggcccgtgcgccgctgccgccggtgtcgttctactacgacctgctgtcgccg
ctctcggctcggctcgacatctggcacaccatctacaaccatccgttggccgatgccgac
gcgatcgtcgagtgggtgaagtcgacagggctgaagcccttcctcgatccgctggacgcc
gatgagcgcaagctgttcctcgacagctacacggccaaggtcgccaaggcctatccgaag
accgccgatggcaaggtgctgctgcgtttcccccgcattttcatcgtcgccaagggggcg
ggatag

DBGET integrated database retrieval system