KEGG   Mesorhizobium australicum: Mesau_04978Help
Entry
Mesau_04978       CDS       T02417                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mam  Mesorhizobium australicum
Pathway
mam00071  Fatty acid degradation
mam00072  Synthesis and degradation of ketone bodies
mam00280  Valine, leucine and isoleucine degradation
mam00310  Lysine degradation
mam00362  Benzoate degradation
mam00380  Tryptophan metabolism
mam00620  Pyruvate metabolism
mam00630  Glyoxylate and dicarboxylate metabolism
mam00640  Propanoate metabolism
mam00650  Butanoate metabolism
mam00900  Terpenoid backbone biosynthesis
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
mam01212  Fatty acid metabolism
mam02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesau_04978
   00630 Glyoxylate and dicarboxylate metabolism
    Mesau_04978
   00640 Propanoate metabolism
    Mesau_04978
   00650 Butanoate metabolism
    Mesau_04978
  Lipid metabolism
   00071 Fatty acid degradation
    Mesau_04978
   00072 Synthesis and degradation of ketone bodies
    Mesau_04978
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesau_04978
   00310 Lysine degradation
    Mesau_04978
   00380 Tryptophan metabolism
    Mesau_04978
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesau_04978
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesau_04978
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesau_04978
Enzymes [BR:mam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mesau_04978
Exosome [BR:mam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesau_04978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: AGB47292
UniProt: L0KPG4
Position
complement(5015638..5016804)
Genome map
AA seq 388 aa AA seqDB search
MTACIVGWAHSRFGKLEGETLENLIVKVATDALDHAGIGPDEVDEIVLGHFNAGFSAQDF
TASLVLQADDRLRFKPATRVENACATGSAAVRQGIRAIDANAARIVLVVGAEQMTTTPGP
EIGKNLLKASYLPEDGDTPAGFAGVFGKIAQAYFQRYGDQSDALAMIAAKNHKNGVDNPY
AQMRKDFGYDFCRQESEKNPFVAGPLKRTDCSLVSDGAAALVLADTATALKMRRAVAFRA
NEHVQDFLPMSKRDILTFEGCEQAWTRALKNAGVTLDDLSFVETHDCFTIAELIEYEAMG
LAKPGEGAKLALDGTTAKDGGLPVNPSGGLKAKGHPIGATGVSMHVLTAMQLVGEAGGIQ
VPGAKLGGIFNMGGAAVANYVSILDRIR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatgcatcgttggctgggcgcattcgcgcttcggcaagcttgagggcgagacg
ctcgaaaacctgatcgtcaaggtcgcgacggacgcgctcgaccatgccggcattggcccg
gacgaggtcgacgagatcgtgctcggccatttcaatgccggtttttcggcgcaggatttc
acggcaagcctggttctccaggcggacgaccggctgcgcttcaagccggcgacacgcgtc
gagaacgcttgcgccaccggttcggcggcggtcaggcaaggtatccgcgccattgatgca
aacgccgcccgcatcgtgctggtggttggcgccgagcagatgacgacgacgcccgggccc
gaaatcggcaagaatttgctgaaagcttcctatctgcccgaggacggcgacacgccagcc
ggcttcgccggcgtcttcggcaagatcgcgcaggcctatttccagcgctatggcgaccag
tcggatgcgctcgccatgatcgctgccaagaaccacaagaatggcgtcgacaatccctat
gcgcagatgcgcaaggatttcggctatgacttctgccggcaggagagcgagaaaaacccg
ttcgtcgcaggacccttgaagcgcaccgactgctcgctggtctccgacggcgccgctgcc
cttgtccttgccgacacggcaacggcgctgaagatgcgccgcgcggtcgccttccgcgcc
aacgagcatgtgcaggatttcctgccgatgtcgaagcgcgacatcctgaccttcgaaggc
tgcgaacaggcctggacccgcgcgctgaagaacgccggcgtaacgctcgacgatctctcc
ttcgtcgaaacgcatgactgcttcactatcgccgaattgatcgagtatgaagcgatggga
ctggccaagccgggtgagggcgccaaactggcgctggatggcacaacggcaaaagacggc
ggcctgccggtcaatccctccggcggactgaaggccaagggccatccgatcggcgccacc
ggcgtatccatgcatgtcttgaccgccatgcagcttgtcggcgaagccggcggcatccag
gtgccgggcgcgaaactcggcggcatcttcaacatgggcggtgcggcggtcgccaactac
gtttccattctcgaccggatcaggtaa

DBGET integrated database retrieval system