KEGG   Mesorhizobium australicum: Mesau_05154Help
Entry
Mesau_05154       CDS       T02417                                 

Definition
(GenBank) glycyl-tRNA synthetase, tetrameric type, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
mam  Mesorhizobium australicum
Pathway
mam00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mam00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mesau_05154
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mam01007]
    Mesau_05154
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mam03016]
    Mesau_05154
Enzymes [BR:mam01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Mesau_05154
Amino acid related enzymes [BR:mam01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Mesau_05154
Transfer RNA biogenesis [BR:mam03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mesau_05154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AGB47464
UniProt: L0KTZ2
Position
complement(5213244..5214188)
Genome map
AA seq 314 aa AA seqDB search
MTIEIPAHMHPSRSFQGLILTLHNYWAAYGCVILQPYDMEVGAGTFHPATTLRALGPKGW
NAAYVQPSRRPKDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGVDPLLHDI
RFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYV
QDVDNVYDLNFNGREGADKVTYGDVFLQAEQEYSRHNFEYANTAMLLRHFEDAEAECKAL
LEAGAPASNDNLPMHKMVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRNLAKAC
GEAFLKTQAGGLAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattgaaatcccagcccatatgcatcccagccgctcgttccaggggctgatcctc
actttgcacaattactgggcggcttatggctgcgttatcctccagccctatgacatggag
gtcggcgccggcacctttcatccggcaacgacgctgcgcgcgctaggtcccaagggctgg
aacgccgcctacgtccagccttcgcgccgtcccaaggacggccgctatggcgagaatccg
aaccggctgcagcactactaccagtaccaggtgatcctgaagcccaatccgcccaatctg
caggagctctatctcggctcgctggcggcaatcggcgtcgacccgttgctgcacgacata
cgtttcgtcgaggacgattgggaaagcccgacgttgggcgcctgggggcttggctgggaa
tgctggtgcgacggcatggaggtgtcgcagttcacctatttccagcaggtctgcggcatc
gaatgcgcgccggtggcgggggaactcacctacggcctggagcgcctggccatgtatgtg
caggacgtcgacaatgtctacgacctcaacttcaacggccgcgagggcgccgacaaggtg
acctatggcgatgtcttcctgcaggccgagcaggaatattcccgccacaatttcgaatac
gccaacacggcgatgctgctcaggcatttcgaggacgccgaggccgagtgcaaggctctg
ctcgaggccggcgcgccggcctcgaacgacaatctgccgatgcacaagatggtcttcccg
gcctatgaccagtgcatcaaggccagccatgtcttcaatttgctggacgcgcgtggcgtg
atctctgtcaccgagcgccagagctacatcctgcgcgtgcgcaatctggcgaaggcctgc
ggcgaggcgttcttgaagacgcaggccggtggattggcggcctga

DBGET integrated database retrieval system