KEGG   Mesorhizobium australicum: Mesau_05416Help
Entry
Mesau_05416       CDS       T02417                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mam  Mesorhizobium australicum
Pathway
mam00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mesau_05416
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mesau_05416
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mesau_05416
    1.1.1.-  
     Mesau_05416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N Glu_dehyd_C ADH_zinc_N Sacchrp_dh_NADP Shikimate_DH ApbA TrkA_N ThiF FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGB47723
UniProt: L0KUF9
Position
complement(5496577..5497605)
Genome map
AA seq 342 aa AA seqDB search
MRAARLYGPGDLRVEDIAAPGIPDAGWVKLRVDAAGICGSDLHNFRTGQWISRAPSTAGH
ELTGTVIALGEGVDTIAVGDRVVADSRFWCGDCAQCRAGKRHLCAALGFVGEICDGGFAE
QAVLPARLLHVIDASLDERVAAMAEPLAVALHAVRRLPKTAGSVLVVGCGPIGGLAALLL
SRTFAGTVLVADRNQARCARVARVTGATIVDLDREVIAAATANVPLLAAIEATGSIAAFS
QLLGVLDPGGAIAMVGIFHGRLDIDPNVLVEREIALLGCHAFADELPDAVRMLGELSEPL
LALVDCEIGLDDIPAAYERLLAGSSDGLKTIIRMRQPAGKDF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagggcggcacgactttatggaccgggcgacctgcgcgtcgaggacatcgccgcgcca
ggcattcccgatgccggctgggtaaagctcagggtcgatgccgccggcatctgcggttcg
gacctgcacaatttccgcaccggccaatggataagccgggcgccctcgacggcgggccac
gagttgaccggcacggtgatcgcgctgggcgagggcgtcgataccattgccgtcggcgac
agggtcgtcgccgattcccgtttctggtgcggagactgcgcgcaatgccgtgccggcaag
cggcatctctgcgcagcgctgggcttcgtcggcgaaatctgcgatggcggctttgccgaa
caggcggtgttgcccgcacgtctgctgcatgtcatcgatgcgagccttgacgagcgcgtc
gcggcgatggccgagccgcttgccgtcgcgctgcacgcggtgcggcgtctgccgaagacg
gcgggttcggttctggtcgtcggctgcgggccgatcggcggtcttgccgcgctgttgctt
tcgcgaaccttcgccggcaccgtgcttgtcgccgaccgcaaccaggcgcgctgcgcccgc
gtggcgcgagtgacgggcgccacgatcgtcgatctcgaccgcgaggtcattgcagccgcg
accgccaatgtcccgttgctggcggccatcgaggcgaccggcagcatcgcggcgttcagc
cagttgctcggcgttctcgatcctggtggtgcgatagcgatggtcggcatcttccatggc
cgcctcgacatcgaccccaatgttcttgtcgaacgcgagatcgcgttgctcggatgccat
gctttcgcggacgaattgccagacgctgtccggatgctgggtgagctgagtgaaccgctg
ctggccctggtcgattgcgagatcggtctggacgacatcccagccgcctatgagcggctg
ttggcgggaagcagcgatggcttgaaaacaatcatccgcatgcggcaacctgccggaaag
gatttttga

DBGET integrated database retrieval system