KEGG   Mesorhizobium amorphae: A6B35_01725Help
Entry
A6B35_01725       CDS       T04446                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00071  Fatty acid degradation
mamo00072  Synthesis and degradation of ketone bodies
mamo00280  Valine, leucine and isoleucine degradation
mamo00310  Lysine degradation
mamo00362  Benzoate degradation
mamo00380  Tryptophan metabolism
mamo00620  Pyruvate metabolism
mamo00630  Glyoxylate and dicarboxylate metabolism
mamo00640  Propanoate metabolism
mamo00650  Butanoate metabolism
mamo00900  Terpenoid backbone biosynthesis
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01120  Microbial metabolism in diverse environments
mamo01130  Biosynthesis of antibiotics
mamo01200  Carbon metabolism
mamo01212  Fatty acid metabolism
mamo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mamo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6B35_01725
   00630 Glyoxylate and dicarboxylate metabolism
    A6B35_01725
   00640 Propanoate metabolism
    A6B35_01725
   00650 Butanoate metabolism
    A6B35_01725
  Lipid metabolism
   00071 Fatty acid degradation
    A6B35_01725
   00072 Synthesis and degradation of ketone bodies
    A6B35_01725
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6B35_01725
   00310 Lysine degradation
    A6B35_01725
   00380 Tryptophan metabolism
    A6B35_01725
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6B35_01725
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6B35_01725
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A6B35_01725
Enzymes [BR:mamo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6B35_01725
Exosome [BR:mamo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6B35_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANT48743
UniProt: G6YAF0
Position
378152..379330
Genome map
AA seq 392 aa AA seqDB search
MSNAIVVAGAARTSVGSFNGAFAATPAHELGAVVIRELLSRTGVEPGEVDEVILGQVLTA
AQGQNPARQASINAGLPKETTAWGLNQVCGSGLRAIALGMQQIAAGDAKVIVAGGQESMS
LSAHAQHLRAGVKMGDYKMIDTMIKDGLWDAFNGYHMGNTAENVARQFQITRDDQDQFAL
ASQNKAEAAQKAGKFKDEIVAFTIKGKKGDTIVDQDEYIRHGATIDAMTKLKPAFDKDGT
VTAANASGINDGAAGALLMSEAEAARRGITPLARIVSWATAGVDPQIMGTGPIPASRKAL
AKAGWSVGDLDLVEANEAFAAQACAVNKDMGWDPSIVNVNGGAIAIGHPIGASGARIFNT
LVFEMRRRGAKKGLATLCIGGGMGVAMCIEAL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgccatcgttgtcgccggcgcggcacgcacgtctgttggctccttcaacggc
gccttcgccgccactccggcgcacgaactcggcgccgtcgtcatccgggagttgctgtca
cgtaccggtgtcgagccgggcgaggtcgacgaggtcatcctcggtcaggtgctgaccgcc
gcccaaggccagaaccccgcccgccaggcctcgatcaacgccggcctgcccaaggagacc
actgcctggggtctcaaccaggtttgcggctcgggcctgcgcgccatcgcgctcggcatg
cagcagatcgccgccggcgatgccaaggtgatcgtcgccggcggacaggaatcgatgtcg
ctatcggcgcatgcccagcatctgcgcgccggcgtcaagatgggcgactacaagatgatc
gacaccatgatcaaggacgggctgtgggatgccttcaacggctaccacatgggcaacact
gccgagaacgtcgcgcgccagttccagatcacccgcgacgaccaggaccagttcgcgctg
gcctcgcagaacaaggccgaggccgctcagaaggccggcaagttcaaggacgagatcgtc
gccttcaccatcaagggcaagaagggcgacaccatcgtcgaccaagacgagtacatccgc
cacggcgccaccatcgacgccatgaccaagctgaagccggccttcgacaaggacggcacc
gtgaccgccgccaacgcctccggcatcaatgacggcgcggccggggcgctgctgatgagc
gaagcggaggccgccaggcgcggcatcaccccgttggcgcgcatcgtgtcctgggccacc
gccggcgtcgatccgcagatcatgggcaccgggcccattcccgcctcgcgcaaggcgctg
gccaaggccggctggtcggtcggcgacctcgacctggtcgaggccaacgaggccttcgcc
gcgcaggcctgcgccgtcaacaaggacatgggctgggatccctcgatcgtcaacgtcaat
ggcggggctatcgccatcggccatccgatcggcgcttcgggtgcccgcatcttcaacacg
ctggttttcgaaatgcgccgccgcggtgcgaagaaaggcctcgccacgctctgcatcggc
ggcggcatgggcgtcgccatgtgcatcgaagcgctctga

DBGET integrated database retrieval system