KEGG   Mesorhizobium amorphae: A6B35_07880Help
Entry
A6B35_07880       CDS       T04446                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00071  Fatty acid degradation
mamo00072  Synthesis and degradation of ketone bodies
mamo00280  Valine, leucine and isoleucine degradation
mamo00310  Lysine degradation
mamo00362  Benzoate degradation
mamo00380  Tryptophan metabolism
mamo00620  Pyruvate metabolism
mamo00630  Glyoxylate and dicarboxylate metabolism
mamo00640  Propanoate metabolism
mamo00650  Butanoate metabolism
mamo00900  Terpenoid backbone biosynthesis
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01120  Microbial metabolism in diverse environments
mamo01130  Biosynthesis of antibiotics
mamo01200  Carbon metabolism
mamo01212  Fatty acid metabolism
mamo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6B35_07880
   00630 Glyoxylate and dicarboxylate metabolism
    A6B35_07880
   00640 Propanoate metabolism
    A6B35_07880
   00650 Butanoate metabolism
    A6B35_07880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6B35_07880
   00072 Synthesis and degradation of ketone bodies
    A6B35_07880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6B35_07880
   00310 Lysine degradation
    A6B35_07880
   00380 Tryptophan metabolism
    A6B35_07880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6B35_07880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6B35_07880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6B35_07880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mamo04147]
    A6B35_07880
Enzymes [BR:mamo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6B35_07880
Exosome [BR:mamo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6B35_07880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ANT49861
UniProt: G6Y3N9
Position
1683356..1684564
Genome map
AA seq 402 aa AA seqDB search
MAEAYVYDAVRTPRGKGKKDGSLHEVPAVRLGAKVLEALRDRNGLDTGAVDDIIFGCVDP
VGEAGSVIPRAAAFEAGYDTKAPGMQLSRFCASGLDAINFGAAKIAQGADEIVIAGGVES
MSRVGMGASGGAWFMDPSVGLPGWFVPQGISADLIATKYGFSRDDVDAYAVESQKRAAKS
WADGRFKNSVIPIKDQNGLTILDHDEHMRPSTDMQSLASLNPSFVMPGEMGGFDAVAVQK
HPEVEEVNHVHHAGNSSGIVDGAAAVLLGSKKAGKSMGLKPRARIRAFANIGSEPVLMLT
GPVDVTEKLLQRAKMKLSDIDLFELNEAFASVVLRYMQAFDIPHDQINVNGGAIAMGHPL
GATGAMIFGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcttatgtctacgacgccgtgcgcacgccgcgcggcaagggcaagaaggat
ggctcgctgcacgaggtgccggcggtaaggctgggcgccaaggtgctggaggcgttgcgc
gaccgcaacgggctcgacaccggcgccgtcgacgacatcatcttcggctgcgtcgacccg
gtcggcgaggccggttccgtcattccgcgcgccgccgctttcgaggctggctacgacacc
aaggcacccggcatgcagctctcgcgcttctgcgcgtccggccttgacgccatcaatttc
ggcgccgccaagatcgcgcagggcgccgacgagatcgtcattgccggtggcgtcgaatcg
atgtcacgcgtcggcatgggcgcctctggcggcgcctggttcatggacccttcggtcggg
ctgcccggctggttcgtgccgcaaggcatctcggccgacctgatagccaccaaatatggt
ttttcgcgcgacgacgttgacgcctatgcggtcgagagccagaagcgcgccgccaagtcc
tgggccgacggccgcttcaagaattcggtgatcccgatcaaggaccagaacggcctcacc
atcctcgatcatgacgagcacatgcggccctcgaccgacatgcagtcgctggcctcgctc
aacccgtccttcgtcatgcccggcgaaatgggcggcttcgatgccgtcgcggtgcagaag
caccccgaggtggaagaggtcaaccacgtccaccatgccggcaattcgtccggcatcgtc
gatggcgccgctgccgtgctgctcggctccaagaaggccggcaagtcgatggggctgaaa
ccgcgcgcgcgcatccgcgccttcgccaatatcggctccgagccggtgctgatgctgacc
ggcccggtcgacgtcaccgaaaagcttttgcagcgcgccaagatgaagctgtcggacatc
gatctgttcgagctcaacgaggccttcgcctcggtggtgctgcgctacatgcaggccttc
gacatcccgcacgaccagatcaacgtcaatggtggcgcgatcgccatgggccatccgctt
ggtgccaccggcgcgatgatcttcggcaccgtcttggacgaactggagcgccgtgacctc
aacaccgcgctggtgacgctgtgcatcggtgccggcatgggtactgcaaccatcatcgaa
cgcgtctga

DBGET integrated database retrieval system