KEGG   Mesorhizobium amorphae: A6B35_07975Help
Entry
A6B35_07975       CDS       T04446                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mamo  Mesorhizobium amorphae
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A6B35_07975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ANT49878
UniProt: G6Y3M0
Position
complement(1703148..1703540)
Genome map
AA seq 130 aa AA seqDB search
MYRAITRNIEVQVRPFYLEDRSDPSENRYVWGYHVTIDNQSDEFVQLMSRYWHITDGTGR
VEEVRGAGVVGDQPELNPGDSYQYTSGCPLSTPSGIMVGHYTMRNKRGETFDIAIPAFSL
DLPGTRRTVN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgccattacgcgcaacatcgaagtgcaggtcaggccgttctatctcgaggat
cgctcggatccgtcggagaaccgctatgtctggggctaccacgtgaccatcgacaaccag
tcggacgagttcgtgcagctgatgtcgcgctattggcacatcaccgatggcactggccgg
gtcgaggaggtacgcggcgccggcgtcgtcggcgatcagcccgaactcaaccccggcgac
agctaccaatatacgtcgggctgcccgctctcgacgccgtccggcatcatggtcggccat
tacacgatgcgcaacaagcggggagagacgttcgacatcgccatccccgccttttcgctc
gatctgccgggcacgcgcaggacggtgaattaa

DBGET integrated database retrieval system