KEGG   Mesorhizobium amorphae: A6B35_11385Help
Entry
A6B35_11385       CDS       T04446                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00430  Taurine and hypotaurine metabolism
mamo00460  Cyanoamino acid metabolism
mamo00480  Glutathione metabolism
mamo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A6B35_11385
   00460 Cyanoamino acid metabolism
    A6B35_11385
   00480 Glutathione metabolism
    A6B35_11385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mamo01002]
    A6B35_11385
Enzymes [BR:mamo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     A6B35_11385
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     A6B35_11385
Peptidases and inhibitors [BR:mamo01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   A6B35_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ANT50483
UniProt: G6YLF1
Position
2482203..2483789
Genome map
AA seq 528 aa AA seqDB search
MRDFQFPGRSPVRATEAMAATSHPLATLAAIDMLRSGGNAMDAAVCAAAVQGVVEPQSTG
IGGDCFVLYCPKGQGEVLAFNGSGRAPAAATVDWYLENGFSELPKQGPHAVTVPGAVDAW
CRLLEDHGRKSIADALAPAIRYAENGYVVHDRVAFDWEDPETDLSLDEVAARIFLPGGKP
PRAGDVHRQPELAETLRIIAKSGRAGFYEGAVAEDIVGRLRQLGGLHTLDDFAATKGDYK
TPVGTSYGGYGIHQMPPNNQGLTALLMLNVLSGFELGALDPNGAERLHLEIEAGRLAYQD
RDAFIGDQDHVAVPVKELLSGTYADRLRAAIDRERAMTHLPRLDLPGSDTVYISIVDRDL
NAVSFINSTYYSFGSGIVGPKTGVVLQNRGSSFRLDPNHPNSIAPGKRPMHTIMPGMMTK
NGRAVMPFGVMGGGYQPFGHVHLLTNMIDFGMDPQQALDAPRVFYNNGVVEAERSVPADA
IEGLRRRGHQVIEPDHPLGGGQAVLIDWEKGTLTGASDPRKDGMALGY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatttccagtttccaggccgttcgccagtccgcgccaccgaggcgatggccgcg
acctcgcatccgctggcgacactagccgccatcgacatgctgcgctccggcggcaacgcc
atggacgccgccgtctgcgccgccgccgtccagggggtggtcgagccgcaatcgaccggc
atcggcggcgactgttttgtcctctattgcccgaaagggcagggcgaggtgctggccttc
aacggttcgggccgcgcgcccgccgccgcgaccgtcgactggtatctggagaacggcttc
agcgagctgccgaagcaaggtccgcacgcggtaaccgtgccgggcgccgtcgacgcctgg
tgccggctcttggaggatcatggccgcaagagcatagccgacgcgctggcaccggcgatc
cgctacgccgaaaacggctatgtcgtgcatgatcgcgtcgccttcgactgggaagatccg
gaaaccgatctgtcgctcgacgaggtggcggcgcgcatcttcctgcccgggggcaagccg
cccagggcgggcgacgtccaccgccagccggagctcgccgaaacgctgcgcatcatcgcc
aagagcggtcgcgccggtttctatgaaggcgcggtggcggaagacattgtcggccggctg
cgccaactcggcggcctgcatacgctcgacgatttcgccgcgacaaagggcgactacaag
acgccggtcggcacctcctatggcggctacggcattcatcagatgccaccgaacaaccag
gggctgacggcgctgctgatgctgaacgtgctctccggcttcgaactcggcgcgctcgat
cccaatggcgcggagcggctgcacctcgagatcgaggccgggcggctggcctaccaggac
cgcgatgcatttatcggcgatcaggaccatgtcgcggtgccggtgaaggaactgttgtcc
ggcacctatgccgacaggctgcgcgccgcgatcgatcgcgagcgcgccatgacgcatctg
ccgcgcctcgacctgccgggcagcgacacggtctacatctccatcgtcgaccgcgacttg
aatgcagtgagcttcatcaactcgacctattattccttcggcagcggcattgtcggaccg
aagaccggcgtcgtcctgcagaaccgtggctccagcttccggctcgatccgaaccatccc
aacagcatcgcgcccggcaagcggccgatgcacacgatcatgcccggcatgatgacgaag
aatggccgtgcggtgatgccgttcggcgtcatgggcggcggctaccagcccttcggccat
gtccacctgctcaccaacatgatcgacttcggcatggacccgcagcaggcgctggacgcg
ccgcgtgtgttctacaacaacggcgtcgtcgaggcggagcgaagcgttccggccgacgcg
attgagggcttgcgccggcgcggccatcaggtgatcgagcccgatcaccctctgggcggc
ggacaggcggtgctgatcgactgggagaagggaacgctgaccggcgcgtccgacccgcgc
aaggatggaatggcgcttggctactga

DBGET integrated database retrieval system