KEGG   Mesorhizobium amorphae: A6B35_13685Help
Entry
A6B35_13685       CDS       T04446                                 

Gene name
ndk
Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00230  Purine metabolism
mamo00240  Pyrimidine metabolism
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01130  Biosynthesis of antibiotics
Module
mamo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mamo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mamo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A6B35_13685 (ndk)
   00240 Pyrimidine metabolism
    A6B35_13685 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mamo04131]
    A6B35_13685 (ndk)
Enzymes [BR:mamo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     A6B35_13685 (ndk)
Membrane trafficking [BR:mamo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    A6B35_13685 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK DUF4192
Motif
Other DBs
NCBI-ProteinID: ANT50893
UniProt: G6Y800
Position
complement(2955087..2955509)
Genome map
AA seq 140 aa AA seqDB search
MAIERTFSMIKPDATRRNLTGAITQMLEDAGLRVIASRRVWMSRREAEGFYAVHKERPFF
GELVEFMSSAPTIVQVLEGENAIAKNREVMGATNPANAAEGTIRKVHALSIGENSVHGSD
APETAAQEIKYWFSDTEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcaccttttccatgatcaagcccgacgcgacgcggcgcaatctcacc
ggtgccatcacccagatgcttgaggatgccggccttcgcgtcatcgcttcgcgccgcgtg
tggatgagccgccgcgaggcggaaggcttttatgccgtgcacaaggagcgtccgttcttc
ggcgagctggtggagttcatgtcctcggcgccgaccatcgtccaggtgctggaaggcgaa
aacgccattgccaagaaccgcgaagtgatgggcgccaccaacccggccaacgccgccgaa
ggcaccatccgcaaggtgcacgcgctgtcgatcggcgagaattccgtgcacggctcggac
gcgccggagaccgccgcgcaggagatcaagtactggttctcggataccgagatcgtcggc
tga

DBGET integrated database retrieval system