KEGG   Mesorhizobium amorphae: A6B35_17035Help
Entry
A6B35_17035       CDS       T04446                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mamo  Mesorhizobium amorphae
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A6B35_17035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ANT51482
UniProt: G6Y901
Position
3648681..3649685
Genome map
AA seq 334 aa AA seqDB search
MEVTVAFPVLVGLVAVALFFDFLNGLHDAANSIATIVSTRVLRPHYAVLWAAFFNFIAFL
FFGLHVAETVGKGIVDASIVTPAVIFAALVGAIVWNIVTWIAGIPSSSSHALIGGLVGAG
VAKAGVGAIVWTGLGKTVAAIVLSPATGFLLALVLILVVSWLFVRQTPFAVDNTFRVMQF
LSASLYSLGHGGNDAQKTMGIIAVLLYSQGMLGETFHVPLWVVLTCQSALALGTLFGGWR
IVHTMGSKITRLNPMQGFCAETGGAITLFAATWLGIPVSTTHTITGAIIGVGAARRVSAV
RWGIAGNIVIAWIVTLPATAAISALTYFVTRLGG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtcaccgtcgcctttcccgttctggtcggcctcgttgccgtggcgctgttcttc
gatttcctgaacggcctgcatgacgccgccaattcgatcgccaccatcgtctcgacgcgc
gtgctgcggccgcattatgcggtgttgtgggcggccttcttcaacttcatcgccttccta
ttcttcggtcttcatgtcgcagagacagtgggcaagggcatcgtcgacgccagcatcgtc
acgccggcggtgatcttcgcagcccttgtcggcgccattgtctggaacatcgtcacctgg
atcgccggcattccttcgagcagctcgcatgcgctgatcggcgggctggtcggcgccggc
gttgcaaaggctggggtcggcgccatcgtctggacgggccttggcaagacggtcgccgca
atcgtcttatcgccggcaaccgggtttctgctggcgctggtgttgatcctggtcgtttcg
tggctgttcgtgcgccagacgcccttcgctgtcgacaacacattccgcgtaatgcagttc
ctttccgcctcgctctattcgctcgggcacggcggcaatgacgcgcagaagaccatgggc
atcatcgccgtgctgctctattcgcaaggcatgctcggcgagacattccacgtgccgctc
tgggtcgtcctcacctgccagtcggcgctggcgctgggcaccttgtttggcggctggcgt
atcgtccacaccatgggctcgaagatcacccggctgaacccgatgcagggcttctgcgcc
gagaccggcggcgccatcaccctgttcgccgccacctggcttggcattcccgtatcgacc
acgcatacgatcaccggcgccatcatcggcgtcggcgccgcccgccgtgtctcggccgtc
cgctggggcatcgcaggcaacatcgtcattgcctggatcgtcaccttgccggcaactgcg
gccatttcggccctcacctattttgtcacgcgcctaggcggctga

DBGET integrated database retrieval system