KEGG   Mesorhizobium amorphae: A6B35_20705Help
Entry
A6B35_20705       CDS       T04446                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00010  Glycolysis / Gluconeogenesis
mamo00071  Fatty acid degradation
mamo00350  Tyrosine metabolism
mamo00625  Chloroalkane and chloroalkene degradation
mamo00626  Naphthalene degradation
mamo00680  Methane metabolism
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01120  Microbial metabolism in diverse environments
mamo01130  Biosynthesis of antibiotics
mamo01200  Carbon metabolism
mamo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6B35_20705
  09102 Energy metabolism
   00680 Methane metabolism
    A6B35_20705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6B35_20705
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A6B35_20705
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A6B35_20705
   00626 Naphthalene degradation
    A6B35_20705
Enzymes [BR:mamo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A6B35_20705
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     A6B35_20705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANT52137
Position
4391324..4392451
Genome map
AA seq 375 aa AA seqDB search
MKTRAAVAVAAGKPLEIMEVDLDGPRDGEVLVEIKATGICHTDEFTLSGADPEGLFPAIL
GHEGAGVVVDVGKGVTSVKKGDHVIPLYTPECRQCPSCLSRKTNLCTAIRATQGQGLMPD
GSSRFSIGKDKLFHYMGCSTFSNFTVLPEIALAKVNPDAPFDKICYIGCGVTTGIGAVIN
TAKVEQGATAVVFGLGGIGLNVIQGLKLAGADMIIGVDLNNDKKPWGEKFGMTHFVNPKE
IDGDIVPHLVNMTKRGADQIGGADYTFDCTGSTKVMRQALEASHRGWGKSVVIGVAGAGQ
EISTRPFQLVTGRTWMGTAFGGARGRTDVPKIVDWYMDGKIQIDPMITHTLKLEDINKGF
DLMHEGKSIRSVVIY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgcgccgctgtcgctgtcgccgccggaaagccgctggagatcatggaggtc
gacctcgacggcccgcgcgatggcgaagtgctggtagagatcaaggcgaccggcatctgc
cacaccgatgagttcacgctgtcaggcgccgatcccgagggtctcttcccggcgattctc
ggccatgaaggtgccggcgtcgttgtcgatgtcggcaagggcgtcacttcggtcaagaag
ggcgaccatgtcatcccgctctatacgccggaatgccggcagtgcccgtcttgtctctcg
cgcaagaccaatctgtgcaccgccatccgcgccacgcagggtcaaggcctgatgccggac
ggctcgtcgcgcttctcgatcggcaaggacaagctgttccactatatgggctgctcgacc
ttctccaacttcaccgtgctgcccgagatcgcgctggccaaggtcaatcccgacgctccc
ttcgacaagatctgctacatcggctgcggcgtcaccaccggcatcggcgcggtgatcaac
accgccaaggtcgagcaaggcgccacggcggtcgtcttcggcctcggcggcatcggcctc
aacgtcatccagggcctgaaactagccggcgccgacatgatcatcggcgtcgacctgaac
aacgacaagaagccctggggcgagaagttcggcatgacgcatttcgtcaatccgaaggag
atcgacggcgacatcgtcccgcacctggtcaacatgaccaagcgtggcgctgaccagatc
ggcggcgccgactacaccttcgactgcaccggcagcaccaaggtgatgcggcaggcgctg
gaagcctcgcatcgcggctggggcaagtcggtcgtcatcggcgtcgccggcgccgggcag
gagatctcgaccaggccgttccagctggtcaccgggcgcacctggatgggcaccgccttc
ggcggcgcgcgcggccgcaccgacgtgccgaagatcgtcgactggtacatggacggcaag
atccagatcgacccgatgatcacccacacgctgaagctcgaagacatcaacaagggcttt
gacctcatgcatgagggcaagtcgatcaggagtgtggtgatttactaa

DBGET integrated database retrieval system