KEGG   Mesorhizobium amorphae: A6B35_23110Help
Entry
A6B35_23110       CDS       T04446                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00670  One carbon pool by folate
mamo01100  Metabolic pathways
mamo01120  Microbial metabolism in diverse environments
mamo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A6B35_23110
Enzymes [BR:mamo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     A6B35_23110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ANT52572
UniProt: G6YEU6
Position
complement(4895219..4896136)
Genome map
AA seq 305 aa AA seqDB search
MNQFRFSRRPDIGDKVRVSFEFFPPKTDEMEARLWDTVTRLEPLKPKFVSVTYGAGGSTR
ERTARTVKRILNETTLTPAAHMTCVDAARDQVDAVVREFADMGVTRFVALRGDPAAGVGT
AYRPHPDGYANGAELVGALKGAGDFDISVSAYPEKHPESPDFATDFDMLKRKADNGATRA
ITQFFFDNDLYERYVERARRAGIYIPIVPGILPVHNFTQVANFSARCGALVPAWLAERFD
GLQNDPQTHALVASAVAAEQVLDLVERGVSDFHFYTMNRADLVFAICHMIGIRSHEAEAA
GSAAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttccgcttttcccgccgtcccgatattggcgacaaggtcagggtttcgttc
gagttcttcccaccgaagaccgacgagatggaggccaggctgtgggacaccgtcacccgg
ctggaaccgctcaagccgaagttcgtctcggtgacctacggagccggcggctcgacccgt
gagcgcaccgcgcgcacggtcaagcgcatcctcaacgaaacgacgctgacgccggcggcg
cacatgacctgcgtcgatgcggcccgcgatcaggtcgatgccgttgtcagggaattcgcc
gatatgggcgtcacccgcttcgtcgccttgcgcggcgatccggcggcaggcgtcggcacc
gcctacaggccgcatcccgacggctacgccaatggcgccgaactggtcggggcgctgaag
ggcgccggcgatttcgacatttcggtctccgcctatccggaaaagcatccggaaagcccg
gacttcgccaccgatttcgacatgctgaagcgcaaggcagacaatggcgcgacgcgggcg
atcacccagttcttcttcgacaatgatctctacgagcgctatgtcgagcgggcgcggcgg
gccggcatctacatcccgatcgtgccgggcattctgccggtgcacaatttcacccaggtc
gccaatttctcggcgcgttgcggcgcgctggtgccggcatggctggccgagcgcttcgac
gggctgcagaacgacccgcagacgcatgcgctggtggcgtccgccgtggcggccgagcag
gtgctcgacctggtcgaacgcggcgtcagcgatttccacttctacaccatgaaccgggcc
gatctggtgtttgccatatgccacatgatcggcatccgctcgcatgaggcggaagctgcg
ggatcggccgcagcctga

DBGET integrated database retrieval system