KEGG   Mesorhizobium amorphae: A6B35_26310Help
Entry
A6B35_26310       CDS       T04446                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6B35_26310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mamo02022]
    A6B35_26310
Two-component system [BR:mamo02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   A6B35_26310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE
Motif
Other DBs
NCBI-ProteinID: ANT53134
UniProt: G6YAN0
Position
5620825..5621544
Genome map
AA seq 239 aa AA seqDB search
METIERVDHPTAPDDDAPHLLVVDDDTRIRNLLKQYLSENGFRVTVAGNSGEARRKLAGL
DFDLLVLDVMMPGETGVDLTKALRAEKNVPILMLTALSETDSRITGLEAGADDYLPKPFD
PRELILRINNILRRGGPATTPKVEQLVFGPYTFQIARRELKRGGEALKLTDREQEILAIF
AARAGETIPRHELVGDDSEVGERTIDVQINRLRRKIERDPSNPVWLQTVRGIGYRLSVE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggagaccattgagagggttgatcatccgactgcaccggacgatgacgcgccgcatctg
cttgtggtcgatgacgacacccgtatccgcaacctgctgaagcagtacctgtccgagaac
ggctttcgcgtcaccgtcgccggaaactccggcgaggccaggcgaaagcttgccggtctc
gatttcgacctgcttgtgctcgacgtcatgatgccgggcgaaaccggcgtcgatctcacc
aaggcgctgcgggcggaaaagaacgtgccgatcctcatgctcaccgcgctgtccgagacc
gacagccgcatcaccgggctcgaggccggcgccgacgactatctgccgaagccgttcgac
ccgcgcgagctgatcctgcgcatcaacaacatcctgcgccgcggcggcccggcgacgacg
ccaaaggtcgagcagctggtgttcggcccctatacgttccagatcgccaggcgcgaattg
aagcgtggcggcgaggcgctgaaactgaccgaccgcgagcaggagatcctggcgatcttt
gcggcgcgggccggcgagacgatcccgcgccatgaactggtcggcgacgattcggaagtc
ggcgagcgcaccatcgacgtccagatcaaccggttgcgccgcaagatcgagcgcgatccg
tccaacccggtctggctgcagacggtgcgcggtattgggtatcggctcagcgtggaatag

DBGET integrated database retrieval system