KEGG   Mesorhizobium amorphae: A6B35_26830Help
Entry
A6B35_26830       CDS       T04446                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00010  Glycolysis / Gluconeogenesis
mamo00020  Citrate cycle (TCA cycle)
mamo00620  Pyruvate metabolism
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01120  Microbial metabolism in diverse environments
mamo01130  Biosynthesis of antibiotics
mamo01200  Carbon metabolism
Module
mamo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6B35_26830
   00020 Citrate cycle (TCA cycle)
    A6B35_26830
   00620 Pyruvate metabolism
    A6B35_26830
Enzymes [BR:mamo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A6B35_26830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 PGAP1 Lipase_3 Thioesterase Abhydrolase_5 Ser_hydrolase FSH1 Esterase BAAT_C DLH Chlorophyllase2 DUF2974 DUF900 DUF1100 DUF915
Motif
Other DBs
NCBI-ProteinID: ANT53232
UniProt: G6YDC1
Position
5727062..5727868
Genome map
AA seq 268 aa AA seqDB search
MSSSLHAAERGIGPKTVAFLHGFGGCHEVWRDVTSMLAPDMRTLAYDLPGHGLSLDFPGS
GSARTAARAALTDLAARGMKRVHLVGHSMGGAVAVLMALAEAERIASLTLLAPGGFGPEI
NGPLLRRYAAATGKSEIRTCLAAMSGPLSQPPEHVVDVLDEMRRRPGQLQKLVEFAASMT
RDDRQGAIPREQLETLKMPVMVIWGTDDAVLPVCQADAMPVHFHLHHVLEAGHMLPEEAP
DLVAMAVRRNMNRRSSRRLQPRLDAAAS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagttcatccctccacgctgccgaacgcggtatcggtccgaagactgtcgccttcctg
cacggcttcggtggctgccatgaggtctggcgcgacgtgacgtcgatgcttgcgcccgac
atgcggacgctggcctacgaccttcccgggcatgggctttctctcgatttccctggcagt
ggttcggccaggacggccgctcgggccgctctgacggaccttgccgcgcgtggcatgaaa
agggtgcacctggtcggccattcgatgggcggcgcagtggctgtgctgatggcattggcc
gaggccgaaagaattgcctcgctgacacttttggcgccaggcggctttggcccggaaatc
aacggccctctcttgcgccgctatgcggccgccaccggcaaaagtgagatccgtacctgt
ctcgctgccatgtccgggccgctgagccaaccccctgagcacgtcgtggatgtgcttgac
gagatgcgtcggcgcccgggtcagttgcaaaagcttgtcgagtttgccgcgtccatgacc
agggatgaccggcagggcgccataccgcgcgaacagctcgaaacgttgaaaatgccggtg
atggttatctggggaacggacgacgctgtgctgcccgtttgccaggccgacgctatgccg
gtgcattttcatctgcaccatgttctggaggctggccacatgctgcccgaggaagcgcct
gaccttgtcgccatggcggtgcgccgcaacatgaaccgccgcagcagcaggcgccttcag
cccagacttgacgcggcggcgagctga

DBGET integrated database retrieval system