KEGG   Micavibrio aeruginosavorus EPB: A11S_1014Help
Entry
A11S_1014         CDS       T02517                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man00970  Aminoacyl-tRNA biosynthesis
man01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:man00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A11S_1014
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:man03029]
    A11S_1014
Enzymes [BR:man01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A11S_1014
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A11S_1014
Mitochondrial biogenesis [BR:man03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A11S_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey ScsC_N
Motif
Other DBs
NCBI-ProteinID: AGH97832
UniProt: M4VEL8
Position
complement(1049077..1050531)
Genome map
AA seq 484 aa AA seqDB search
MAQTIKTDTGVWEIVIGMEVHAQVTANSKLFSGSSATFGAAPNSQVSMVDAAMPGMLPVL
NEYCVEQAVRTGLGLNAQINMTSVFERKNYFYPDLPQGYQISQFLHPIVGKGEIEIDLPD
GTVKTIGITRLHLEQDAGKSLHDQHPQKSFVDLNRSGCALMEIVSEPDIRGADEATAYLS
KLRMVLRYLGTCDGNMEEGSMRADVNVSVRRLGVKELGTRCEIKNVNSLKAVQMAIEYEA
ARQIEIIEGGGEIKQETRLWDPSKGETRSMRSKEEAHDYRYFPDPDLLPLNLKSDWVEKI
KATLPELPDQKKHRFMDSYGLSAYDSSVLIAERARADYYEAVAKGRDAKLAANWVLNELL
GILNKDGKTISESPVTAAMLGLMIERITDNTISGKIAKDVFAEMYASGKDADTIIETKGL
KQVTDTGAIEKIVEEVLNENPQIVADYKGGNEKVFGFLVGQVMKKSQGKVNPGMANELLK
KKLS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaattaaaacggacacaggcgtttgggaaatcgtcatcggcatggaagtc
cacgcccaggtgaccgccaattccaaattgttttccggttcatccgccacattcggcgcc
gccccgaacagccaggtcagcatggtggatgccgccatgcccggcatgctgcccgttttg
aacgaatattgcgttgaacaggccgtgcgcacgggtctgggcctgaatgcgcagatcaac
atgacgtcggtgttcgaacgcaaaaactatttctaccccgacctgccgcagggttatcag
atttcgcaattcctgcacccgatcgtgggcaagggcgaaattgaaatcgacctgccggac
ggcacggtgaaaaccattggcattacccgcctacatttggaacaggatgccggtaaatcc
ctgcacgaccagcacccgcaaaaatccttcgtcgatttgaaccggtccggctgcgccctg
atggaaattgtgtcggaaccggatattcgcggcgcggatgaagccaccgcgtacctgtcg
aaactgcgcatggttctacgctatctcggcacatgcgatggcaacatggaagaaggatcc
atgcgtgccgacgtgaacgtatccgtgcgtcgtctgggcgtgaaagaactgggcacgcgg
tgcgagatcaagaacgtgaactcgttgaaagccgttcagatggcgattgaatacgaagcc
gcccgccagatcgaaattatcgaaggcggcggtgagattaaacaggaaacacgcctgtgg
gacccatccaagggcgaaacccggtccatgcgatccaaggaagaagcgcacgattaccgt
tacttcccggacccggacctgttgccgctgaacctgaaatccgactgggttgagaagatc
aaggcgaccctgccggaactgccggaccagaagaaacaccgtttcatggattcctacggc
ctgtccgcctatgattccagcgtgttgatcgcggaacgtgcccgtgcggattattacgaa
gccgtggccaagggccgtgacgccaaactggccgccaactgggttctgaacgaattgctg
ggcattttgaacaaggatggcaagacgatcagcgaaagccccgtcaccgccgccatgctg
ggcctgatgatcgaacgcatcaccgacaacacgatcagcggcaaaatcgccaaggacgtg
ttcgccgaaatgtacgcatcgggcaaggacgccgatacgatcatcgaaaccaagggcctg
aaacaggtgaccgacaccggtgcgatcgaaaagatcgtggaagaagtgttgaacgaaaac
ccgcaaatcgttgccgattataaaggtggcaatgaaaaggtcttcggcttcctggtcggt
caggtgatgaaaaagtctcagggcaaagtcaacccgggcatggccaacgaattgctgaag
aaaaagctctcgtaa

DBGET integrated database retrieval system