KEGG   Micavibrio aeruginosavorus EPB: A11S_1016Help
Entry
A11S_1016         CDS       T02517                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A / Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man00970  Aminoacyl-tRNA biosynthesis
man01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:man00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A11S_1016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:man03029]
    A11S_1016
Enzymes [BR:man01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A11S_1016
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A11S_1016
Mitochondrial biogenesis [BR:man03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A11S_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGH97834
UniProt: M4VXB0
Position
complement(1051162..1052652)
Genome map
AA seq 496 aa AA seqDB search
MSNALTDLTIASALDGLKKKEFTATELTAAHVKVMENTRHLNAYITETPDVAMKQAAESD
ARYAAGKNGALDGIPLGIKDLFCTNGIRTTAASKILGNFVPHYESTVTTKLLNDGAVFMG
KLNLDEFAMGSSNTTSAFGNVISPWKRNNGDNADLVPGGSSGGSSAAVAARSCMGATGTD
TGGSIRQPASFCGIAGIKPTYGRCSRWGVVAFASSLDQPGVFARNTEDCALLLKSVAGHD
PKDATSANKPVPDFVAALGKSVKGMKVGIPREYAVDGMPAEIQKLWDEGKAYLKDAGAKI
VDVSLPHTKYSLATYYIIAPAECSSNLARYDGVRYGMRAEGKDLREVYENTRAQGFGEEV
RRRIMVGTYVLSAGYYDAYYTKAQKVRRLISEDFLNAYKECDVLLTPTAPSAAFAIGENE
DDPIKMYLNDVFTVPASLAGMPGMSVPAGLSGDGLPLGLQIIGKPWDEETVLNVSQVIEK
AANFTAVPQMVVKKAA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgccctgaccgacctgaccattgcctccgctttggacggattgaagaaaaaa
gaattcaccgcgactgaattgaccgccgcgcatgtgaaggtgatggaaaacacccgtcac
ctgaacgcctatatcaccgaaacgccggacgtggccatgaaacaggccgcggaatccgac
gcgcgttacgccgcgggcaaaaatggtgcgctggacggtattccgctggggattaaggac
ctgttctgcaccaacggtatccgcaccacggcggccagcaaaattctgggcaatttcgtg
ccgcattacgaatccaccgtcacgaccaagttgctgaatgacggtgcggtgttcatgggc
aaactgaacctcgacgaatttgcgatgggatcgtccaacacgaccagcgcgttcggcaac
gtgatcagcccgtggaaacgcaataacggcgataatgccgatctggttccgggcggttcg
tccggtgggtcctccgctgctgtggccgcacgctcttgcatgggcgcaacgggcacggat
acgggcggttccatccgccagccggccagcttctgtggcattgccgggatcaagccgacc
tatggccgctgctcccgctggggtgtggttgcgttcgcgtcatcgctggaccagccgggc
gtgttcgcccgcaacaccgaagattgcgcattgctgttgaaatccgttgccgggcacgac
ccgaaggatgcgacatccgctaacaaaccggtgccggattttgtggccgcgttgggcaaa
agcgtaaaaggcatgaaggtcggcattccgcgcgaatatgcggtggacggcatgcccgcc
gaaatccaaaaattgtgggatgaaggcaaagcgtatttgaaagatgccggcgcgaaaatc
gtcgatgtatccctgccccacacgaaatattcgttggcgacctattacatcatcgcccct
gcggaatgctcgtccaacctcgcccgttatgacggcgtgcggtatggcatgcgcgccgaa
ggcaaggatctgcgcgaagtgtatgaaaacacccgcgcacagggctttggcgaagaagtc
cgccgccggatcatggtcggaacttacgttctgtccgccgggtattacgatgcgtattac
accaaggcccagaaagtccgccgtttgatttcggaagacttcctgaacgcttacaaggaa
tgcgatgtcctgctgaccccgaccgcgccgtccgccgcgttcgccattggcgaaaacgaa
gacgatccgatcaagatgtacctgaacgacgtgttcacggttccggcctcgttggccggt
atgccgggcatgtccgttccggcgggtttgagcggtgacggcctgcccctgggcttgcag
atcattggcaagccgtgggacgaggaaaccgttctgaacgtgtcgcaggtgattgaaaag
gccgcaaacttcaccgccgttccgcaaatggtcgtgaagaaagccgcatga

DBGET integrated database retrieval system