KEGG   Micavibrio aeruginosavorus EPB: A11S_905Help
Entry
A11S_905          CDS       T02517                                 

Definition
(GenBank) DNA-binding response regulator PetR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man02020  Two-component system
Brite
KEGG Orthology (KO) [BR:man00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A11S_905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:man02022]
    A11S_905
Two-component system [BR:man02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   A11S_905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGH97727
UniProt: M4VEC4
Position
938316..939032
Genome map
AA seq 238 aa AA seqDB search
MSADMQIADKLATRPHILVVDDDDRIRQLVTRFLHENGFVVASAESAAGARELLAHLDFD
AMVVDIMMPGETGLELTQSIRAHSDIPVLMLTALGEADDRIAGLETGADDYLAKPFEPRE
LVLRLNAILRRRPKPVTDMRVRLGRWVYDPAMNVLQNDGDIQALTTVETTLLKALISRAG
EAISREDLARMCNLDDSGERTIDVQVTRLRRKIEQDTRTPLVLQTVRGKGYMLRVDPV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagatatgcaaattgcggacaagctggccacacggccgcatattctggtcgtc
gatgacgatgaccggattcgccagctcgtcacccgcttcctgcatgaaaatggatttgtc
gtggcctccgccgaaagtgcggcgggtgcgcgtgaattgctggcgcatctggatttcgat
gccatggttgttgatatcatgatgccgggtgaaacggggctggagctgacccaatccatc
cgcgcacacagcgatattccggtgctgatgctgaccgcgttgggggaggcggatgaccgc
atcgcggggcttgaaaccggagccgatgattatttggcaaagccgttcgagccgcgtgaa
ttggttttgcgcctgaacgctattttgcgccgccgcccaaaacccgtgaccgatatgcgc
gtccgattggggcggtgggtgtatgacccggcaatgaatgtcttacaaaatgacggggat
attcaggcgctgacgaccgttgagaccaccttgctgaaagccctgatcagccgcgcgggc
gaggccatcagccgcgaggatctggcgcgcatgtgcaatctggatgacagcggtgaacgg
acgattgatgttcaggtcacgcgcctgcgccgcaagattgaacaggatacgcgcacgccg
ctggtcctgcaaaccgtgcggggcaagggctatatgctgcgggtggatccggtatga

DBGET integrated database retrieval system