KEGG   Micavibrio aeruginosavorus EPB: A11S_925Help
Entry
A11S_925          CDS       T02517                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man00071  Fatty acid degradation
man00072  Synthesis and degradation of ketone bodies
man00280  Valine, leucine and isoleucine degradation
man00310  Lysine degradation
man00362  Benzoate degradation
man00380  Tryptophan metabolism
man00620  Pyruvate metabolism
man00630  Glyoxylate and dicarboxylate metabolism
man00640  Propanoate metabolism
man00650  Butanoate metabolism
man00900  Terpenoid backbone biosynthesis
man01100  Metabolic pathways
man01110  Biosynthesis of secondary metabolites
man01120  Microbial metabolism in diverse environments
man01130  Biosynthesis of antibiotics
man01200  Carbon metabolism
man01212  Fatty acid metabolism
man02020  Two-component system
Brite
KEGG Orthology (KO) [BR:man00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A11S_925
   00630 Glyoxylate and dicarboxylate metabolism
    A11S_925
   00640 Propanoate metabolism
    A11S_925
   00650 Butanoate metabolism
    A11S_925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A11S_925
   00072 Synthesis and degradation of ketone bodies
    A11S_925
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A11S_925
   00310 Lysine degradation
    A11S_925
   00380 Tryptophan metabolism
    A11S_925
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A11S_925
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A11S_925
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A11S_925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:man04147]
    A11S_925
Enzymes [BR:man01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A11S_925
Exosome [BR:man04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A11S_925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FKBP_N
Motif
Other DBs
NCBI-ProteinID: AGH97746
UniProt: M4VI71
Position
960715..961926
Genome map
AA seq 403 aa AA seqDB search
MTTNDPIVIVAAKRTPIGNFNGGLSTLPAHDLGAVAIRAVMDEAKVGGADIDEVIMGQVL
TAAAGQNPARQAAMAAGIPHEKTALTVNQVCGSGLRTVALGMQSILNGDATVIVAGGQEN
MSLSPHAMHMRNGTKMGNATMVDTMIVDGLWDAFNGYHMGMTAENIAEKWQITRADQDNF
AAASQQKTEAAQKAGKFTAEITPVKIKVKKDEVTIDKDEFPRAGVTAESLSGLRPAFKPD
GTVTAASASGINDGAAAVVLMRASEAKKRGLPVYATIRSWATAGVDPAVMGSGPIPASRK
ALEKAGWSVSDLDLVEANEAFAAQSLCVLKDLALDPAKVNVNGGAIAIGHPIGASGTRVL
VTLLHEMARRDAKRGLVTLCIGGGMGIAMCVERDASENLKKVA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaatgatcctatcgttatcgtcgccgccaaacgcacaccgattggcaacttc
aatggcggactcagcacactgcctgcccatgatctgggcgcggttgccattcgcgcagtc
atggacgaagccaaagttggcggggccgatatcgacgaagtaattatgggccaggtcctc
accgctgccgccggacaaaacccggcccgccaggccgcgatggccgcgggcattccgcat
gaaaaaactgcactgaccgttaatcaggtttgtggctcgggcttgcgcacggtagcgctc
gggatgcaatccatcctgaacggtgacgccactgtcatcgtcgcgggcgggcaggagaat
atgagcctgtcgccacatgccatgcatatgcgtaacggcacgaaaatgggcaatgccacg
atggtcgatacgatgatcgttgatggtctgtgggatgcgtttaacggctaccacatgggc
atgaccgccgaaaacattgccgaaaaatggcagatcacccgtgcggatcaggataatttt
gcagccgcctcccaacaaaaaaccgaagccgcacaaaaggccggtaaattcaccgccgaa
atcaccccggtgaaaatcaaggtgaagaaggatgaagtgaccattgataaagacgaattc
ccgcgcgcgggcgtgacggcggaatcgctgtccggcctgcgcccggcgttcaaacccgac
ggcacagtaacagcggccagcgcatccggcatcaatgacggtgctgccgctgttgttctg
atgcgtgccagcgaggcgaagaaacgcggtctgccggtctatgcgaccattcggtcctgg
gccacggcgggcgttgatccggcggtgatgggctccggtccgatcccggcatcgcgcaag
gcgctggaaaaagcgggttggtccgtatccgatctggatctggtcgaagcgaacgaagct
ttcgccgcgcaatctctgtgcgtgctgaaagatctggcgctggacccggcgaaggtgaac
gtgaatggcggggcgattgccatcggccatccgattggtgcgtcgggtacgcgcgttctg
gtcacgctgttgcacgaaatggcacgccgtgatgcgaaacgcggtctggtgacattgtgc
atcggcggcggcatgggtattgccatgtgcgttgagcgcgatgcatccgaaaatttgaaa
aaagttgcttaa

DBGET integrated database retrieval system