KEGG   Methylomusa anaerophila: MAMMFC1_02878Help
Entry
MAMMFC1_02878     CDS       T05819                                 

Gene name
cfiB
Definition
(GenBank) 2-oxoglutarate carboxylase small subunit
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mana  Methylomusa anaerophila
Pathway
mana00020  Citrate cycle (TCA cycle)
mana00620  Pyruvate metabolism
mana01100  Metabolic pathways
mana01120  Microbial metabolism in diverse environments
mana01200  Carbon metabolism
mana01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAMMFC1_02878 (cfiB)
   00620 Pyruvate metabolism
    MAMMFC1_02878 (cfiB)
Enzymes [BR:mana01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MAMMFC1_02878 (cfiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 ATP-grasp_3 HlyD_D23 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BBB92193
UniProt: A0A348AM95
Position
complement(3165217..3168666)
Genome map
AA seq 1149 aa AA seqDB search
MKKIHTVLVANRGEIAIRVFRACNELGIRTIAIYSKEDIFSLHRYTADEAYLIGEGKGPI
GAYLDIEGIMEIAKKRGVDAIHPGYGFLSENINLAKRCAEEGFIFIGPEMQHLQMFGDKI
NARKKAVEVGLPVIPGSDGPVTDIEEVKTFAAQHGFPFIIKAILGGGGRGMRIVRTAAAL
EESYHRAKSEAQSSFGNDEIYLEKLIEYPKHIEVQILGDKFGNIVHLFERDCSVQRRHQK
VIEIAPSISLSNELRLSICNAAVKLMRHVGYISAGTVEFLVTSDQSFYFIEVNPRIQVEH
TITEMVTGIDMVQAQLLIADGYRLYDEEVGIPQQENIRCNGHAIQCRITTEDPSNQFMPD
TGKISVYRSAGGPGVRLDAGNAYAGSVITPFYDSLLVKVSTWGLTHKSAIAKMKRCLGEF
RIRGIKTNIAFLYNVVNHEKFLHGTYDTTFIDTSPELFVLPIPRDRATKLLTYLGDVSVN
GFAGIKKSPKPEFPPVRFPSTPTTGNIPPGTKQILDQMGPAGLVAWIKEQKEVLLTDTTW
RDGHQSLLATRIRTRDIVNISESTASLLPNLFSLEMWGGATFDVAYRFLKEDPWQRLASL
RQKVPNILFQMLLRGSNAVGYTNYPDNLIKSFVAHSAEAGIDVFRIFDSLNWITGISVAI
EAVRESGKVAEAALCYTGDILDQSRSKYNLAYYINMAKELERAGAHILAIKDMAGLLKPE
AAYRLISSLKEAVNIPIHLHTHDTSGNGIYTYARAIEAGVDIVDAAVSSLAGMSSQPSAN
TLYYALEHNERQPKVDITALYELSHYWQDVRNYYKDFESSQFFPNPEVYLHEMPGGQFSN
LKQQAKVLGLENQWDKIKEVYRQVNYMFGDIVKVTPSSKVVGDMTLYMVENNLTEDDIYE
RGETLNFPNSVVEFFAGHLGQPYQGFPKELQRIILKGRSPLTNRPGETMEAINFTEIRDT
VNNLLQRPVTFADVLSYSLYPKVFTDWTNFANAYGDVSIIDTPTFFYGLVSREEIQVDIE
EGKTLVIKLVSIEEPMPNGKRIVNFELNGLPREVAIKDHSIVATVITRLKAEEENPSHIG
ATLSGKVVKLFVDKGNVVKKGTPLLVTEAMKMETTILAPFDAVVKDIHIKPNETIETGDL
LLELTKTPT
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatacatactgtactggtcgccaatcggggagaaattgccatacgggtattc
cgggcctgcaatgaattaggtatacgcactatagcaatttattccaaagaagatattttt
tctttgcaccggtacacagcggatgaagcctatttaatcggtgaaggtaaaggccctatc
ggcgcttatctcgatattgaaggcatcatggaaatcgctaaaaagcgcggtgtagacgcc
attcatccgggctacggttttttatcggaaaatattaatctggctaaacgctgcgctgag
gaagggtttatttttattggacctgaaatgcagcatttacagatgtttggtgataaaata
aacgcccgtaaaaaagccgtcgaagtaggattaccggtcatccccggcagcgacggacca
gtcacggacattgaagaagtaaaaacttttgccgctcagcacggctttcctttcatcatc
aaagccatcttgggcgggggcggccgcggcatgcgcattgtccgcactgccgccgccctg
gaagaatcgtaccaccgggcgaaatccgaagcccaatcgtcttttggcaatgatgagata
tacctggaaaaacttattgaataccctaaacatattgaagttcagatattgggtgacaaa
ttcgggaatatcgtccacctttttgaacgggattgctcagtgcagcggcgtcatcaaaag
gttattgaaattgctcccagcatatctttatctaacgaattgcggctatccatctgcaat
gccgctgtcaaactcatgcggcatgtcggctacataagtgccggcactgtggaatttctc
gtcacttcggatcagagcttctatttcattgaagttaatccccgcatacaggtagaacat
accattaccgagatggtaacaggcatcgatatggtgcaggcacagcttcttattgccgat
ggctaccgcctttatgacgaggaagtgggcatcccgcagcaagaaaacatccgctgtaac
ggtcacgccattcagtgccggattactaccgaagatccgtctaaccaatttatgccggac
accggcaaaatcagcgtctatcgcagtgccggcggccccggagtacggctggatgcaggc
aatgcctatgccgggtcggttatcacgcctttttacgattccctgctggtaaaagtgtct
acctgggggctgacgcacaaaagcgccatcgccaaaatgaaacgctgtttgggtgaattt
cgtatccggggcattaaaaccaatattgcttttctatacaatgtagtaaatcacgaaaaa
ttcttacacgggacttatgacaccacctttattgacacatcgcccgaacttttcgtactc
cctatccccagggaccgggccacgaaactgttaacctacctgggcgatgtttcggtcaac
ggcttcgcaggaataaaaaagtcccccaaacctgaattcccgccggtgcggtttcccagc
acacctactactggaaacataccaccgggaacaaaacaaattctggaccaaatgggaccg
gcaggactggtagcctggattaaagaacaaaaagaagtactattaacggacaccacctgg
cgggacggccaccagtccctgcttgccacccggatacgcactcgtgatatagtaaatata
agcgagtccactgccagcctgctgccaaatctattttctctggaaatgtggggcggcgcc
acttttgatgtcgcctaccggttcttgaaggaagacccctggcagcgactggccagcctg
agacaaaaggttcccaacatattattccagatgctcttaagagggtccaatgccgtaggc
tatacaaattatcccgacaacctgatcaagtccttcgtagcccactccgccgaagcaggg
attgatgttttccgtatctttgatagcctgaactggattaccggtatatccgtcgccatc
gaagccgtcagggaatccggcaaagttgccgaagctgcgttgtgttacaccggtgatatt
ctcgaccagtcgcggagcaaatataacctggcttactatataaacatggccaaggaatta
gagcgggccggagcccacattctggccatcaaggacatggccggcttgctaaaaccggaa
gctgcctatcgtctgatatcttccttaaaagaggcggtaaatattcccatccatctccac
actcatgataccagcggtaacggtatctatacctatgcccgcgccattgaggcgggtgtg
gacatagttgacgcggcggtttcctcgctggcaggaatgtcttctcagcccagtgccaat
actttatattacgccctggagcacaacgaacgccagcccaaggtcgacattaccgcctta
tacgaactatcccattactggcaggatgtcagaaattattataaagattttgaaagcagt
cagtttttccctaacccggaagtatacctgcatgaaatgccgggtggacagtttagtaat
ttgaaacagcaggccaaagtcctgggcttggaaaatcagtgggacaaaatcaaggaggtc
tatcgccaagtcaattatatgttcggagatatcgtaaaagtaaccccatcctcaaaggtt
gttggtgacatgaccttgtatatggtggaaaataacttgaccgaagatgatatttacgag
cggggcgaaaccctcaactttcccaactcggttgtggaattttttgccggtcacctgggt
cagccctatcaagggttcccgaaagaattacagcgtattatccttaaggggcgttcccca
ttgaccaaccgcccgggggaaaccatggaagcaatcaactttacagaaatacgcgacacg
gtaaataacctgttgcagcgtccggttacctttgctgatgttctttcctactctttatat
cccaaggtctttactgactggactaacttcgccaacgcctacggtgatgtcagtataata
gacacgccgacatttttctatggtcttgtctcccgtgaggaaatacaggtagatattgaa
gagggaaaaactttggtaataaaactggtttccattgaggaacctatgcccaatggaaaa
agaatcgttaattttgaactcaacggactaccccgggaagtagccatcaaggaccatagc
attgttgccacggtaattacccgcttaaaagcggaagaagaaaaccccagtcatatcggc
gcgacattatcgggaaaagtagtcaagttgtttgtagacaaggggaatgtggtaaaaaaa
gggacaccgctcctggtaaccgaggccatgaaaatggaaacaacaattctggcgccgttt
gacgctgtcgtgaaagacatacacatcaaacccaacgaaacgatagaaaccggcgacttg
ctgttggagttgacgaaaactccaacatag

DBGET integrated database retrieval system