KEGG   Methylomusa anaerophila: MAMMFC1_03321Help
Entry
MAMMFC1_03321     CDS       T05819                                 

Gene name
rluD_2
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mana  Methylomusa anaerophila
Brite
KEGG Orthology (KO) [BR:mana00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mana03009]
    MAMMFC1_03321 (rluD_2)
Enzymes [BR:mana01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MAMMFC1_03321 (rluD_2)
Ribosome biogenesis [BR:mana03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MAMMFC1_03321 (rluD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 ThiS
Motif
Other DBs
NCBI-ProteinID: BBB92626
UniProt: A0A348ANH8
Position
complement(3655730..3656611)
Genome map
AA seq 293 aa AA seqDB search
MRSFVIPEGFDGMSVKDFLRRDGISLSLWRKIKQSGSVEVNGLPAAPRTPLKAGDVIRVI
WPVANDLAPIPLDLVIRYEDDYLLVVDKPPGLLVHPVSLSQETTLANGIINYFQTKGLSC
GFHPVNRLDRNTSGLVLIAKAPDVHHLLNQRFPLISKEYLAIVSGVPYPLSGIIEAAISR
CPDSIIKRMVNPGGQSSITAFQVVHVLTNNIASLVKLSLKTGRTHQIRVHMSHIGHPLLG
DDLYGGSTELISRQALHASRLVFPHPVSRQSLSIESPLPDDICALLTRLSNNW
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagtttcgttattcccgaaggctttgacgggatgtcggttaaagattttctccgc
cgcgacggcatatccttaagtctttggcgaaaaattaaacagtccggcagtgttgaagtc
aatggtttgccggctgctccccgcacgccattgaaagcaggggatgttatccgcgtaatc
tggccggtggcgaacgatctggccccaataccgttagacctcgtcatccgttatgaagat
gattatcttttggtcgtggataaaccgcccgggcttctcgttcatcccgtgagtctcagt
caggaaactaccttggccaacggcattattaactactttcaaacgaaaggcttatcatgc
gggtttcatccggtgaatcgtcttgaccggaatacctccggcctggtccttatcgccaag
gcgcctgatgtccaccacctgttgaatcagcgttttcccttaattagcaaagaatattta
gcaatagtgtccggcgttccttatccattatccggtataatagaggccgcaatatcccgc
tgtccggacagtatcatcaaacgtatggtgaatcctggcggccaatcgtctattactgcc
tttcaggtagtccatgttttgaccaacaatattgccagcctggttaaactttccctcaaa
accggacggactcatcagatccgggtacatatgagccatatcggtcatcctctgctggga
gatgatttatacggcggttccactgaactcatctcccggcaggcccttcacgcttcccgc
cttgttttcccccaccctgtatcacggcaatcattgtccattgaaagtccgcttcccgat
gacatctgtgcactgttaacaagattgtccaacaactggtga

DBGET integrated database retrieval system