KEGG   Methylomusa anaerophila: MAMMFC1_03343Help
Entry
MAMMFC1_03343     CDS       T05819                                 

Definition
(GenBank) methylmalonyl-CoA carboxyltransferase 5S subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mana  Methylomusa anaerophila
Pathway
mana00620  Pyruvate metabolism
mana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAMMFC1_03343
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mana02000]
    MAMMFC1_03343
Enzymes [BR:mana01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     MAMMFC1_03343
Transporters [BR:mana02000]
 Other transporters
  Primary active transporters [TC:3]
   MAMMFC1_03343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: BBB92648
UniProt: A0A348ANK0
Position
complement(3679186..3680541)
Genome map
AA seq 451 aa AA seqDB search
MASRNPVKITETVLRDGHQSLTATRMRTSDMLPVVEQLDDMGFFSLEAWGGATFDSCLRF
LNEDPWERLRTLKKYIRKTPIQMLLRGQNVLGYNHYADDVVTEFVKRSVANGVGVIRIFD
ALNDVRNLEVSAQAAKEAGAHVQGAFVYTISPYHDNTSFLKVAKDLVSLGVDSICIKDMA
GLLHPYAAYDLVKMLKTEITVPIQLHTHYTSGMASMTYLKAIEAGVDIIDCALSPFSIGS
SQPATEALIAALEGTDRDTGIKKEALYPVADHFRTVKKQLAETFKLNTAIDIDTKVLSFQ
IPGGMLSNLLNQMEEQGMADKFPDVIEEMPKVRAEMGYPPLVTPTSQIVGSMAAFNVMLG
RYKVVPREIKDLARGKYGRTPAPIDPEFLKNIIGIGDEDIITCRPADNIPPQMAKLRQEL
AEKGYPDASAEDVLSYGLFPEVAIKFFENNR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccgaaatccagttaaaattactgaaacagttttacgtgatggtcatcaatca
ctgaccgctaccagaatgcgtacttccgacatgttgcctgttgtagagcagcttgacgat
atggggttcttttccctcgaagcttggggcggagccacctttgacagctgcctccgtttt
ttaaatgaggacccttgggaacgtctgcgcacgctaaaaaaatatataaggaaaactccc
attcagatgctgttaagaggccaaaatgtattgggatacaatcattacgccgatgacgtt
gtgacggagtttgttaaacgctcagtcgcgaacggtgtaggtgttatacgcatattcgac
gctttaaatgacgtccgtaatctggaagtctcggcccaagcggctaaagaagccggcgcc
catgttcaaggagcttttgtatataccattagcccttatcatgataataccagcttttta
aaagtagcaaaggatctggtaagcctcggtgtcgattccatttgtattaaggacatggca
ggacttttgcatccctatgccgcctacgatttggtcaaaatgttaaagactgaaatcacc
gtacccattcaactccacactcactacaccagcggtatggcatccatgacttatttgaag
gccattgaggcaggtgtagacattatcgactgtgctctatcgcctttttccatcggatca
tcccagcctgcgaccgaagccttgattgctgccctggaaggtaccgacagagatacagga
attaaaaaagaagcgctctaccctgttgctgatcatttccgtacagtaaaaaagcaatta
gccgaaacatttaaactaaacactgctattgacatcgatactaaagttctctcttttcaa
attcccggcggcatgctttctaacctccttaaccaaatggaagagcagggaatggccgac
aaattccctgacgtgatcgaggaaatgcctaaagtccgggctgaaatgggttatccgccg
cttgttactcccaccagccagatcgtcggctcgatggcagcttttaatgtcatgctgggc
cgttacaaggtagtcccccgggaaatcaaagacttggctcgcggtaaatacggacgtaca
ccggcgccaattgatccggaattcctaaagaacatcattggcattggcgatgaagacatt
attacctgtcgaccggcagacaatattccgccgcaaatggcgaaactgcgccaggaactg
gctgaaaaaggctatcctgacgcttcggcggaagatgtgctttcttacggattatttccg
gaagtcgccatcaaattctttgaaaacaaccgctaa

DBGET integrated database retrieval system