KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0347Help
Entry
MAP4_0347         CDS       T02662                                 

Definition
(GenBank) putative acid phosphatase
  KO
K21302  phosphatidylinositol-3-phosphatase [EC:3.1.3.64]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00562  Inositol phosphate metabolism
mao01100  Metabolic pathways
mao05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MAP4_0347
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    MAP4_0347
Enzymes [BR:mao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     MAP4_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase Sulfatase
Motif
Other DBs
NCBI-ProteinID: AGL35311
Position
complement(398574..399476)
Genome map
AA seq 300 aa AA seqDB search
MSRENRSRRRLIGGAYRSLRLLGAVAAVALAASPLTPRTSLAAAAIPQPSHIVIVVEENR
SESGIIGNKSAPFITALAASGANMTQSFAETHPSEPNYLALFAGNTFGVTKDLCPVNAGA
APNLGSELLAAGYTFVGYAEGLPSPGSPVCSAGKYARKHVPWANFTNVPAASSLPFSAFP
MGNYASLPTVSFVIPNNDNNMHDGSIAQADSWLNRQLSGYANWALANNSLLIVTFDEDDN
SNVGASRNQIPTVFYGAHVRPGNYAEQINHYNVLATLEQMYGLPKTGYAAGAAPITDIWG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgcgaaaatcgaagtcgcagaaggctgatcggcggcgcataccgaagcctgcgg
ctgctcggcgccgtggccgcggtggcgctggcggccagcccgttgacaccgcgcaccagc
cttgcggcagcggccattccgcaaccgtcgcacatcgtgatcgtggtggaggaaaaccgt
tccgagagcggcatcatcggcaacaagtcggcgcccttcatcaccgcgctggccgcgtcc
ggcgccaacatgacccagtcgttcgccgaaacccaccccagcgagcccaattacctggcg
ctgttcgccggcaacacgttcggggtgaccaaggacctgtgcccggtcaacgccggcgcc
gcacccaacctggggtccgaattgctcgccgccggttacacattcgtcggctacgccgag
ggcctgccgtccccgggctcaccggtgtgtagtgcgggcaagtacgcgcgaaaacatgtg
ccgtgggccaacttcaccaacgtgccggcggctagctcgctgccgttctcggcgttcccg
atgggcaactacgccagcctgccgacggtgtcgttcgtcatcccgaacaacgacaacaac
atgcacgacggctcgatcgcgcaggccgactcctggctgaaccggcagctgtccggctac
gccaattgggcgctggccaacaacagcctgctgatcgtcaccttcgacgaggacgacaac
tccaacgtcggagccagccgcaaccagatccccacggtgttctacggcgcccacgtccgg
cccggcaactacgccgagcagatcaaccactacaacgtgcttgccaccctcgagcagatg
tacgggctgcccaagacgggctatgccgccggcgccgcccccatcaccgacatctggggc
tga

DBGET integrated database retrieval system