KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1195Help
Entry
MAP4_1195         CDS       T02662                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00790  Folate biosynthesis
mao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAP4_1195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mao04147]
    MAP4_1195
Enzymes [BR:mao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     MAP4_1195
Exosome [BR:mao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAP4_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGL36132
Position
complement(1250140..1250424)
Genome map
AA seq 94 aa AA seqDB search
MAVLTDEQIDAAMPDLDGWERADGALRRSIKFPSFLDGIDAVRRVAEHAESKDHHPDIDI
RWRTVTFALVTHSEGGITQNDVDMARDINGIVGS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgttaacggatgagcaaatcgacgccgcaatgcccgatctggacggatgggag
cgtgccgacggcgcgctgcggcggtcgatcaagtttcccagcttcctggacggcatcgac
gccgtgcgccgggtagccgagcacgcggaaagcaaggatcaccaccccgacatcgacatt
cgttggcggacagtgactttcgcgctcgtcacgcattccgagggcggtatcacccaaaac
gacgtcgacatggcgcgcgacatcaacggcatcgtcggcagctag

DBGET integrated database retrieval system