KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1561Help
Entry
MAP4_1561         CDS       T02662                                 

Definition
(GenBank) glutamate 5-kinase protein proB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00330  Arginine and proline metabolism
mao00332  Carbapenem biosynthesis
mao01100  Metabolic pathways
mao01130  Biosynthesis of antibiotics
mao01230  Biosynthesis of amino acids
Module
mao_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MAP4_1561
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MAP4_1561
Enzymes [BR:mao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MAP4_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ACT_7
Motif
Other DBs
NCBI-ProteinID: AGL36489
Position
1682003..1683106
Genome map
AA seq 367 aa AA seqDB search
MTAHRDAIRTARSMVVKVGTNALTTPAGVFDAGRLAGLADAIEARMKAGTDVVIVSSGAI
AAGIEPLGLSRRPRDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLSAHDISMRAQ
HTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGAEALVLLSDIDG
LYDSDPRKTKGAKFIPEVTGAEDLAGVVAGPGSDLGTGGMTSKMSSALLAADAGVPVLLA
AAADAASALTDASVGTVFAARPVRMSARRFWVRYAAEAAGALTLDEGAVRAVVHQRRSLL
PAGITAVSGRFYAGDVVELRGPDAVPVARGVVAYDTTELATMMGRSTSELPGELRRPAVH
ADDLVAV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccaccgcgacgccatccgcacggcgcgcagcatggtggtcaaggtgggcacc
aacgcgttgaccaccccggccggggtgttcgacgccggccggctggccgggctcgccgac
gccatcgaggcgcggatgaaggccggcaccgacgtcgtcatcgtctcgtcgggtgccatc
gccgcgggcatcgagccgctcggattgtcccgtcgccccagggatctggcgaccaagcag
gccgcggccagcgtcggtcaggtggcactggtgaattcctggagcgcggcgttcgcccgc
tacggccgcaccgtcgggcaggtgctgctgagcgcgcacgacatctcgatgcgcgcccag
cacaccaacgcccagcgcaccctggatcggctgcgcgccctgcatgcggtggcgatcgtc
aacgagaacgacaccgtggccaccaacgagatccggttcggcgacaacgaccggctctcg
gcgctggtggcccacctggtcggcgccgaggcgctggtcttgctgtccgacatcgacggc
ctttacgactcggacccgcgaaagaccaagggagccaagttcattccggaggtgacgggc
gcggaggatctggccggcgtggtcgccggcccgggcagcgacctgggcaccggcggcatg
acgtcgaagatgtcctcggcgctgctggccgccgacgccggggtgcccgtgctgctggcc
gccgcggccgacgccgccagcgcgctcaccgacgcttcggtcggcacggtgttcgccgcc
cggccggtgcggatgtcggcccggcggttctgggtgcgctacgccgccgaggcggccggc
gcgctgaccctggacgagggcgcggtgcgcgccgtggtgcatcagcgccgctcgctgctg
cccgcgggcatcaccgcggtgtccggccggttctacgccggcgacgtcgtggaactgcgc
gggccggacgcggtgccggtggcccgcggcgtggtggcctacgacaccaccgaactggcg
accatgatggggcgctcgaccagtgagctgcccggcgagctgcgcaggcccgcggtgcac
gccgacgacctggtggcggtgtga

DBGET integrated database retrieval system