KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2962Help
Entry
MAP4_2962         CDS       T02662                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00071  Fatty acid degradation
mao00072  Synthesis and degradation of ketone bodies
mao00280  Valine, leucine and isoleucine degradation
mao00310  Lysine degradation
mao00362  Benzoate degradation
mao00380  Tryptophan metabolism
mao00620  Pyruvate metabolism
mao00630  Glyoxylate and dicarboxylate metabolism
mao00640  Propanoate metabolism
mao00650  Butanoate metabolism
mao00900  Terpenoid backbone biosynthesis
mao01100  Metabolic pathways
mao01110  Biosynthesis of secondary metabolites
mao01120  Microbial metabolism in diverse environments
mao01130  Biosynthesis of antibiotics
mao01200  Carbon metabolism
mao01212  Fatty acid metabolism
mao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP4_2962
   00630 Glyoxylate and dicarboxylate metabolism
    MAP4_2962
   00640 Propanoate metabolism
    MAP4_2962
   00650 Butanoate metabolism
    MAP4_2962
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MAP4_2962
   00072 Synthesis and degradation of ketone bodies
    MAP4_2962
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP4_2962
   00310 Lysine degradation
    MAP4_2962
   00380 Tryptophan metabolism
    MAP4_2962
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAP4_2962
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP4_2962
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MAP4_2962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mao04147]
    MAP4_2962
Enzymes [BR:mao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAP4_2962
Exosome [BR:mao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAP4_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NPCBM_assoc Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AGL37838
Position
complement(3281624..3283147)
Genome map
AA seq 507 aa AA seqDB search
MNLDPNTPVIVGVGQFTERIEDSGYRGMSSVELATEAARAALHDCGADATALAAAVDTVA
AIRQFELSGRTPAPMGKSNNYPRSVARRIGAAPARAVLEPIGGQGPQHLVTEFAGIIAAG
DAEVVMIFGSENTSSIRYFADREKPDHSETVEGSLEDRGFGYEGLFDDYTVAHGLIGAPA
QYGLLENARRARLGLSVADYRRRMGELFAPFTKVAAKNPSASAPVERSVDELITVTPSNR
MICDPYPRLLVARDQVNQGAAALLMSVAAARRLRVPEERWVFLHGHADMVDQPLLDRLDL
TYNSASVLAVQEALAGAGIGIDDVSTFDLYSCFPVPVFNFCDGTGLATDDPRGLTLTGGL
PYFGGPGNNYSLHGIAETVSEMRDRPGQFGLVAANGGIMSKYSVGVYSTTPVNWKPDNSA
ALRAEVAARPTVPVTVRADGRATIETYTVRYDWPVRTGIIIGRLDDGSRFLALTEDPELV
GLLSDGEPLGTSIVVTATEKDNRATLA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgaccccaacacccccgtcatcgtcggggtggggcagttcaccgagcgcatc
gaggactccgggtaccgcggcatgtcgtcggtggagctggcgacggaagcggcgcgggcc
gcgctgcacgactgcggggccgacgccaccgccctcgccgcggccgtcgacaccgtcgcc
gcgatccggcaattcgagctgtccgggcgcacgcctgcacccatgggtaagtccaacaac
tacccgcggtcggtcgcgcggcggatcggcgccgccccggcccgcgccgtcctcgaaccc
atcggcggccagggcccccagcatctggtcaccgagttcgccggcatcatcgccgcgggg
gacgccgaggtcgtgatgatcttcggctccgaaaacacttccagcatccggtatttcgcc
gaccgggagaagccggaccactccgagacggtcgagggttccctcgaggaccggggtttc
ggctacgaaggcctgttcgacgactacaccgtcgcccacggcctgatcggcgcgccggcc
cagtacgggctgctggagaacgcgcgccgcgcccggctgggcttgagcgtggccgactac
cggcgccggatgggcgagctgttcgccccgttcaccaaggtggcggccaagaacccgtcc
gcgtccgccccggtggaacgcagcgtcgacgagctcatcacggtgaccccgtccaaccgg
atgatctgcgatccctacccccggctgctggtggcccgcgaccaggtcaaccagggcgcg
gcggcgctgttgatgtcggtggccgccgcgcggcggctccgcgtgcccgaggagcgctgg
gtgttcctgcacggacacgcggacatggtggaccagccgctgctggaccgcctcgacctg
acctacaactcggcgtcggtgctggcggtccaggaggcgctggccggggcgggcatcggc
atcgacgacgtctcgacgttcgatctgtacagctgcttcccggtgccggtgttcaacttc
tgcgacggcacgggcctggccaccgacgatccgcgcggcctgacgctcaccggcggcctg
ccgtacttcggcggaccgggcaacaactactcgctgcacggcatcgccgagacggtcagc
gaaatgcgggaccggccaggccaattcggcttggtcgccgccaacggcgggatcatgagc
aagtactccgtcggggtgtactcgaccacgccggtgaactggaaacccgacaacagcgcc
gcgctgcgcgccgaggtcgccgcccgtcccacggttccggtgaccgtcagggcggacggt
cgcgcgaccatcgagacctacaccgtgcgctacgactggccggtgcgcaccggcatcatc
atcggccgcctcgacgacggcagccgctttttggccttgaccgaggatcccgagctggtc
ggcctgctcagcgacggcgagccgctcgggacgtcgatcgtggtcacggcgaccgagaag
gacaaccgggccacgctggcctga

DBGET integrated database retrieval system