KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0269Help
Entry
Maqu_0269         CDS       T00454                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00860  Porphyrin and chlorophyll metabolism
maq01100  Metabolic pathways
Module
maq_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Maqu_0269
Enzymes [BR:maq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Maqu_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABM17375
UniProt: A1TXA6
Position
complement(312293..312916)
Genome map
AA seq 207 aa AA seqDB search
MAKRKNSPMTTTVIDLIRHGEPEGGQMFRGSKDDPLSDTGWQQMIAAIAEGDQWDAIVSS
PMQRCQRFAQQLADEHRIPLHIEEDLREIGFGEWEGLTAEQIQERYGDHLNHFWQDPINF
LPPGGEAVTDFYQRTIDGFDRWQQTLAGKRVLVVCHGGVIRMVLANVLGIPLERSFTGFA
VPYACRSRIQVDQSEFGVFRSLISHQP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaagcggaagaatagccctatgaccaccacagtaatcgacctgatacgccacggc
gaaccggaaggcggccagatgttccggggcagtaaagacgaccccttgagcgacaccggg
tggcaacagatgatagctgccatcgccgagggtgatcagtgggacgccatcgtcagttca
cccatgcaacgatgccagcgttttgcccagcaactggccgatgaacacagaattccactg
catatcgaagaagatctccgggagatcggctttggtgagtgggaagggttgaccgctgag
cagatccaggagcgctatggggatcatcttaaccacttctggcaggaccccatcaacttc
ctcccccccggcggtgaggctgtgacggatttctaccagcgcactattgacggttttgat
cgatggcagcaaacacttgccggcaaacgggtcttggtggtctgccacggaggcgtgatc
cgcatggtgctggccaatgtattgggcattccgctggagagatcattcaccggctttgcc
gtgccttacgcctgccgcagccggatacaggtggaccagtccgaattcggtgtgtttcgc
agcctgatcagccaccagccttga

DBGET integrated database retrieval system