KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0357Help
Entry
Maqu_0357         CDS       T00454                                 

Definition
(GenBank) NAD pyrophosphatase/5'-nucleotidase NadN
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00230  Purine metabolism
maq00240  Pyrimidine metabolism
maq00760  Nicotinate and nicotinamide metabolism
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Maqu_0357
   00240 Pyrimidine metabolism
    Maqu_0357
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Maqu_0357
Enzymes [BR:maq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Maqu_0357
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     Maqu_0357
CD molecules [BR:maq04090]
 Proteins
  Maqu_0357
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:maq00537]
 Enzymes
  Maqu_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: ABM17462
UniProt: A1TXJ3
Position
complement(411912..413735)
Genome map
AA seq 607 aa AA seqDB search
MIRQGLWLAIPLIALTGCNSDNDDAPATETERFTVNILHINDHHSHLEAGSQSLDIAGEE
TEFSAGGFPRVIAKINERAAELDNVLKLHAGDAMTGTLYFTSFEGEADAELMNQVCFDAF
ALGNHEFDRGDEGLVKFLDYLAAGSCNTAVLAANVKPAIGTPLAPVAQDDYIQPYTIKNI
DGQQLAIIGIDIANKTRNSSSPMASTEFLDETETAQAMIDELNDQGIDKIILLTHYQYAN
DLALAERLSGVDVIIGGDSHTLLGTFDAYGLSASGPYPTEVTNADGDKVCVAQAWQYSRV
LGELSVTWENNGTVSSCSGTPHLLLGNPIIRDDGTDDGYQPQGEELAAIRAAIEADPQLS
LVTDDPTGAQTLATYANQLDSFRNQVIGTASEDLCLARIPGRPYGDDTCANEDPNRGGDI
PNLVAQAFLFQSKNADVSIQNAGGVRTDILAGDITIGDAYNLLPFANTLTDLTMTGAEIR
QVLNEAVDFAHVEGGSTGAYPYAAGLRWTVDMTRPAGERLYDIEVRPRSETTWRALTDGE
TLNVVTNSFTAAGRDGYLTFGTVSEDGRATDTFLDYAQSFVDYVKEEVTLSKPAQGEYST
QMYTPAP
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgattcgacaaggactctggctggcaatcccgctgattgccctgaccggctgtaacagt
gataacgacgacgcgcccgccacggaaaccgagcgctttaccgttaacatcttgcatatc
aacgaccaccactcccatctggaagcgggctcacagtccctggatatcgctggtgaagaa
accgaattcagcgccggcggcttcccccgggtgatcgccaagatcaacgaacgagccgcc
gaactggacaacgtgctgaaactgcatgccggagatgccatgaccggcaccctgtacttc
acctccttcgaaggtgaggccgatgccgagctgatgaaccaggtttgttttgatgccttt
gcactgggcaatcacgagtttgatcgtggtgacgaagggctggtgaaattcctcgactac
ctggcggcaggcagctgtaacacggcggttctcgcggccaacgtcaaaccggccatcggc
accccattggcaccggtggcccaggacgattacattcagccatacaccatcaagaacatt
gatggccagcagttggccatcatcggcatcgacatcgccaacaaaacccgcaacagctca
agcccaatggcaagcactgagtttctggacgaaaccgaaaccgcccaggccatgattgat
gagctgaacgaccagggcatcgacaagatcatcctgctgacccactaccagtatgccaac
gatctggcgctggccgagcgcctgtctggagtggatgtcattatcggcggagattcccac
accctgcttggcacctttgacgcctacggcctgagcgcctcaggtccctaccccaccgaa
gtgaccaatgccgacggcgacaaagtgtgcgtggcccaggcctggcagtattcgcgtgtg
ctgggtgaactcagcgtgacctgggagaacaatggcactgtttcctcctgctccggaacg
ccacacctgctcctgggcaaccccatcatccgtgatgacggcaccgacgatggctaccaa
ccccaaggcgaggaactggccgccattcgggcagccatcgaggcggacccgcaactcagc
cttgtgacggacgacccgaccggcgctcaaaccctggccacgtacgccaaccagttggac
agcttccgcaatcaggtcatcggtaccgcatccgaggacctgtgcctggcccgaattccc
ggccggccatacggcgatgacacctgcgccaacgaagacccgaaccgggggggggatatc
ccgaacctggtggctcaggccttcctgttccagagcaagaatgccgatgtttcgatccag
aacgccggcggcgttcgcaccgacattctggccggcgatatcaccattggtgatgcctac
aacctgctgccgtttgccaatacccttaccgatttgaccatgaccggagcagaaatcaga
caggtgctgaatgaagcagtggatttcgcccacgttgaaggcggctccacgggtgcctac
ccctatgccgccggtctgcgctggaccgtcgacatgaccaggcctgctggcgaacgcctt
tacgacatcgaagttcggccccggagtgaaaccacctggcgcgctctgaccgacggtgaa
accctgaacgtcgtcaccaacagcttcaccgcggctggccgtgacggctacctgaccttc
ggaaccgtcagtgaggatggccgagccacggataccttcctggactatgcccaatccttc
gtcgattacgtcaaggaagaggtcaccctcagcaagcccgcccaaggcgagtactccact
cagatgtacacgccagcaccgtaa

DBGET integrated database retrieval system