KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0359Help
Entry
Maqu_0359         CDS       T00454                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00480  Glutathione metabolism
maq00590  Arachidonic acid metabolism
maq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Maqu_0359
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Maqu_0359
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Maqu_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx DUF4174 AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABM17464
UniProt: A1TXJ5
Position
416418..416966
Genome map
AA seq 182 aa AA seqDB search
MMRWTVLKCVSVLLLLGLTVPAVARDCPDFLDHEQRKLHSRDSVNLCEVAAGKPMLVVNT
ASRCGYTGQFEGLEALHQRYKDRGLMVVGFASDDFRQEADSEEEAAKVCFVNFGVSFTMI
APSAVTGEQANPVFQEINRQSQPPRWNFTKYVIDGDGKVTARFPSQVRPEDARLIQALES
VL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgttggacagtcttgaagtgtgtgagtgtgcttttactgttagggttgacggtg
cctgccgttgcccgggattgcccggatttcctggaccacgagcagcgcaagctgcactcc
cgggattcggtgaatctgtgcgaggtggctgctggcaagccgatgctggtggtgaacaca
gccagccgttgtggttataccggtcagtttgaaggcctggaggccctgcaccagcggtac
aaggatcgggggctgatggtcgtgggatttgccagtgatgacttccggcaagaggcggat
tccgaagaagaggccgcgaaggtctgttttgtgaactttggcgtgagttttaccatgatc
gcgccgagcgcagtgaccggtgagcaggccaatccggtgtttcaggaaatcaatcgccag
agccagccgccacgctggaacttcaccaagtatgtgatcgatggtgacggtaaggtgacg
gcccgtttcccgagccaggtgcgccccgaggatgcccggttgattcaggccctggaatcg
gttctgtaa

DBGET integrated database retrieval system