KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1157Help
Entry
Maqu_1157         CDS       T00454                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00020  Citrate cycle (TCA cycle)
maq00640  Propanoate metabolism
maq00660  C5-Branched dibasic acid metabolism
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01200  Carbon metabolism
Module
maq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maqu_1157
   00640 Propanoate metabolism
    Maqu_1157
   00660 C5-Branched dibasic acid metabolism
    Maqu_1157
Enzymes [BR:maq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Maqu_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABM18248
UniProt: A1TZS9
Position
1318339..1319505
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGIACDTPKEAVAAADEIGGDGWVVKAQVHAGGRGKAGGV
KLVKSKEEIREFAEKWLGKNLVTYQTDENGQPVSKILVESLTDIDQELYLGAVVDRGSRR
IVFMASTEGGVEIEKVAEETPEKILKAEIDPLVGAQPYQGRELAFKLGLEGKQIGQFTKI
FLGLAKLFEECDLALVEINPLVITPAGDLHCLDAKVGVDGNALYRQKKIHEMHDPSQEDS
REAEAAKWELNYVALEGNIGCMVNGAGLAMGTMDIIKLSGGQPANFLDVGGGATKERVSE
AFKIILSDDAVQAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGTKV
LAESGLNIIAATSLADAAEQVVKAAGGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcacgaatatcagggcaagcagctgttcgctgagtacggcctgcccgtatcc
aaaggcattgcctgcgatactcccaaggaagccgtagcagcggcagacgaaatcggcggt
gacggctgggtagtgaaagcccaggttcacgccggtggtcgcggcaaggccggcggtgta
aagctggtcaagagcaaagaagagatccgtgaattcgccgaaaagtggctgggtaagaac
ctggttacctaccagaccgacgaaaacggccagccagtcagcaagattctggttgaatcc
ctcaccgacatcgatcaggaactttacctgggcgctgtggtagaccgtggttcccgtcgt
atcgttttcatggcctccactgaaggtggcgtggaaatcgagaaggttgccgaagaaact
ccggaaaagatcctgaaagccgaaattgatccgctggtcggcgcgcagccgtaccagggt
cgtgaactggcattcaagctgggcctggaaggcaagcagatcggtcagttcaccaagatt
ttcctgggcctggccaaactgtttgaagagtgcgacctggctctggttgagatcaacccg
ctggtgatcaccccggctggtgacctgcactgcctcgacgccaaagtaggtgtagacggc
aacgcactgtaccgtcagaagaaaatccacgagatgcacgatccctcccaggaagattcc
cgggaagcggaagcggccaagtgggagctcaactatgttgcgctggaaggcaacatcggc
tgcatggttaacggtgctggcctggccatgggcaccatggacatcatcaagctgtccggc
ggccagcctgccaacttcctggacgtaggcggcggcgcaaccaaagagcgcgtatccgaa
gcgttcaagatcatcctgtctgacgacgcggtacaggccgttctggttaacatcttcggt
ggtattgttcgctgcgacatgatcgctgagggcatcatcggtgcggttaaagaagtcggc
gttaaagtgcctgttgtggttcgtctggaaggcaacaacgcggagctgggtaccaaggta
ctcgccgaaagtggcctgaacatcatcgccgccaccagcctggcggacgccgcagagcaa
gtcgttaaagccgcagggggtaaataa

DBGET integrated database retrieval system