KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2226Help
Entry
Maqu_2226         CDS       T00454                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00471  D-Glutamine and D-glutamate metabolism
maq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Maqu_2226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:maq01011]
    Maqu_2226
Enzymes [BR:maq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Maqu_2226
Peptidoglycan biosynthesis and degradation proteins [BR:maq01011]
 Precursor biosynthesis
  Racemase
   Maqu_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABM19305
UniProt: A1U2T6
Position
complement(2493492..2494337)
Genome map
AA seq 281 aa AA seqDB search
MTDRRPRVLVFDSGVGGLSVAACIHQTLPGAELVYLADNAGFPYGDKPEQVVIERCCTLI
RQCLAQFPCDVVVVACNTASTVVLPELRANIAVPVVGVVPAVKPAAACSVNRRIGLLATP
ATVKRAYLDDLIQKFARDCEVVRLGHPALVRWAEELVGGSAPDQVEVDGAMVPLREAGVD
TVVLGCTHYPLLLPWLRKALPEVMHWVESGEAIARRVAWWFEQAGDLACAQTPPNHSGAV
VISACFSGDAPDDVGPFMSEMGIPVGGVAGHWPGVTATGSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccgtcgcccgagggtgctggtgtttgattccggggtcggtggcctgagtgtc
gccgcctgtattcaccagacgttacccggtgcggagctggtttacctggcagataatgcc
ggctttccctatggcgacaagcccgaacaggtggtgatcgagcgctgttgcacgcttata
cggcaatgcctggcccagtttccgtgcgatgtggtggtggtggcctgtaataccgccagt
accgttgtcttgcccgagctcagggccaacattgctgtgccggtggtcggggtggtgccg
gcggtcaaaccggcggcagcctgttccgtcaatcgccgcattggcctgttggcgacaccg
gcgacagtcaagcgcgcctatctggatgatctgattcagaagtttgcgcgagattgtgag
gtagtccgccttggtcatcccgccctggtgcgctgggctgaggagctggttggcggctct
gcgccggatcaggtggaggtggatggcgccatggtgccgctgcgcgaagccggtgtcgac
acggtggttctgggctgcactcattacccgctattgttgccttggttacgcaaggcgttg
ccggaggtgatgcactgggtggagtccggcgaggcgatagcccgccgtgtggcttggtgg
tttgaacaggccggtgacctagcctgcgcgcagacaccaccgaaccactccggggctgtg
gtgatcagtgcctgcttttctggtgatgcgccggacgatgttggcccgttcatgtcggaa
atgggcatcccggtggggggggtggccggccactggcccggcgttacagcaaccgggtca
gtttga

DBGET integrated database retrieval system