KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2703Help
Entry
Maqu_2703         CDS       T00454                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00520  Amino sugar and nucleotide sugar metabolism
maq00550  Peptidoglycan biosynthesis
maq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Maqu_2703
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Maqu_2703
Enzymes [BR:maq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Maqu_2703
Peptidoglycan biosynthesis and degradation proteins [BR:maq01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Maqu_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABM19778
UniProt: A1U459
Position
complement(3029680..3030942)
Genome map
AA seq 420 aa AA seqDB search
MDKLLIRGRKPLDGEIRISGAKNAALPILAATLLADEPVTVGNLPHLNDITTMIELLGRM
GVELLIDEKMSVEVHANTIKHFHAPYELVKTMRASILVLGPLVAHFGEAEVSLPGGCAIG
TRPVNLHIHGLEMMGADIKVENGYIKAKTNGRLKGAHIFLDTVTVTGTENLMMAAALAEG
KTILENAAREPEVVDLAECLIAMGADIKGHGTATIEINGVERLHGCHYNVLPDRIETGTY
LVAAAATGGRVKVKDTREDILEAVLLKLEEAGAHITTGPDWIELDMKGKRPKAVSLRTAP
YPAFPTDMQAQFAAMNAVAEGSGTIVETVFENRFMHLQELIRMGADITLEGNAAIIKGVE
HLTGAPVMATDLRASASLVIAGLMADGDTIVDRIYHIDRGYECIEEKLQLLGASIRRLPA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaactattgatcaggggtcgaaagcccctggatggcgaaattcgcatttccggt
gccaagaacgcggccctgcccattctggcggcgacactgctggcggatgagccggttacc
gtcggcaacctgccgcacctgaacgatattaccaccatgatcgagctgctcggtcgcatg
ggggtggagctgctcattgacgaaaagatgagtgttgaagtgcacgccaacaccatcaag
cacttccatgcaccgtacgagctggtaaagaccatgcgcgcctccatactggtgcttggc
ccgctggtggcacattttggcgaagccgaagtctccctgccgggtggctgtgccatcggt
acccgaccggttaacctgcacatccacggtctggaaatgatgggtgccgacataaaggtg
gagaatggttacatcaaggccaagaccaatggccggctgaagggtgcccacatcttcctg
gatacggtcaccgtaacgggtaccgaaaacctgatgatggcagctgcgctcgccgagggt
aaaaccatcctcgaaaacgcggcccgtgagccggaagtggtggatctggccgagtgcctg
atcgccatgggtgccgatatcaaaggccacggtaccgcgaccattgaaatcaatggtgtg
gagcgcctgcacggatgccactacaacgtgctgccggaccggatcgagaccggaacctac
ctggtggcggcggctgcgaccggtggtcgggtgaaagtaaaagatacccgggaagatatc
ctggaagcggtgctgctcaagctggaagaggcgggggcgcacatcacgaccggcccggac
tggattgaactggacatgaaaggcaagcggcccaaggctgtcagcctgcggaccgcgccg
tatccggcgttcccaacggatatgcaggctcagtttgcggccatgaatgcggtcgccgag
ggttccggaaccatcgtcgaaaccgtatttgaaaaccgcttcatgcacttgcaggaactg
atccggatgggtgcagacattacccttgaaggtaatgcggccatcatcaagggcgttgaa
cacctgaccggtgctccggtgatggcaaccgatctgcgggcctcagccagcctcgtgatc
gccggtctgatggcagacggcgataccattgtcgaccgcatttaccacattgaccgcggt
tacgaatgcattgaagagaaattgcagctgttgggtgccagcatccgccgtctgccagcc
tga

DBGET integrated database retrieval system