KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2768Help
Entry
Maqu_2768         CDS       T00454                                 

Definition
(GenBank) GTP-binding protein, HSR1-related protein
  KO
K03665  GTPase
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
KEGG Orthology (KO) [BR:maq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:maq03009]
    Maqu_2768
Ribosome biogenesis [BR:maq03009]
 Prokaryotic Type
  GTPases
   Maqu_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP-bdg_N GTP-bdg_M MMR_HSR1 Arf RsgA_GTPase FeoB_N TniB ABC_tran ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ABM19843
UniProt: A1U4C4
Position
complement(3095460..3096758)
Genome map
AA seq 432 aa AA seqDB search
MFERPDVGERAVLVHIDFTAHDDTEDPGEFRELVTSAGVEPVATVTGTRKQPSPRFFVGE
GKLEEIRDAVAASEADVVLFNHALSPSQERNIERELKCRVLDRTGVILDIFAQRARTHEG
KLQVELAQLEHMSTRLVRGWTHLERQKGGIGLRGPGETQLETDRRLLRERIKSIHRRLEK
VRKQRDQGRRARKRADIPTLSLVGYTNAGKSTLFNRITTSSVYAADQLFATLDPTLRRLE
LPDIGPVVMADTVGFIRHLPHKLVEAFRATLEETTQATLLLHVIDCHDSRRDENIEQVES
VLAEIGADEIPMLQVFNKIDLLDGFEPRIDRNEEGLPVRAWVSAVSGEGLPLLFDAIVER
LAEDVVHHFVRLGPADGKLRALLHEAGSVLSEEHCDNGDQVLEVRLQNRDWLQLLSRAGV
REDVIRLESRPV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgagcgtccagatgtcggagaacgggcggttctcgttcacattgattttaccgcc
catgacgataccgaagatccgggagagttccgggaactggtgacctccgccggcgtagag
ccggttgctacggtaaccggcacccggaagcagcccagcccgcgtttttttgtgggagag
ggcaagcttgaggaaatccgggatgcggtggctgcctccgaggccgatgtggtgctgttc
aatcatgccttgagcccgagccaggaacgtaacattgagcgcgagctcaagtgccgggtg
cttgatcgcacgggcgtgatcctggatatctttgcgcagcgggcccggacccacgagggc
aagctgcaggtggaactggcgcagctggagcatatgtctacccggctggtacggggctgg
actcacctcgaacgccagaagggtggtatcggtttgcgagggccgggtgaaacccagctc
gaaaccgaccgccggctgttgcgcgaacgcatcaaatccattcaccggcgtctggaaaag
gtccgcaagcaacgggatcaggggcgccgcgcccgcaagcgtgccgacatacctacgttg
tcgctggtgggttataccaacgccggcaagtccacgctgttcaaccgaattaccacttcc
agcgtatatgcagcagaccagttattcgcgaccctggatccgaccttgcgccggctggaa
cttcccgacatcggaccggtcgtaatggccgatacggtgggcttcatccggcatttgccg
cacaagctggtggaggccttccgggcgacgctggaagaaaccacacaggccacgttgctg
ttgcatgtgatcgactgtcacgacagccgccgggatgaaaacatcgagcaggtggaaagc
gtgctggccgaaatcggagctgatgagattccgatgctacaggtgttcaacaagattgat
ctgcttgatggttttgagccccgcattgatcgcaacgaagaaggattgccggtgcgagcc
tgggtgtcggccgtaagtggtgagggcctgccgctgctgtttgacgccatcgtcgagcgt
ctggcagaggatgtcgtgcaccactttgtgcgtctgggtccggccgatggcaagctcaga
gcgctgctgcacgaggctggttcggttctgagcgaagagcattgcgacaacggcgatcag
gtactggaagtccggttgcagaaccgggactggctgcagcttttgagccgtgccggtgtg
cgtgaagacgtgatccggttggaaagccggccggtctga

DBGET integrated database retrieval system