KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3352Help
Entry
Maqu_3352         CDS       T00454                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00010  Glycolysis / Gluconeogenesis
maq00051  Fructose and mannose metabolism
maq00562  Inositol phosphate metabolism
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01200  Carbon metabolism
maq01230  Biosynthesis of amino acids
Module
maq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_3352
   00051 Fructose and mannose metabolism
    Maqu_3352
   00562 Inositol phosphate metabolism
    Maqu_3352
Enzymes [BR:maq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Maqu_3352
Exosome [BR:maq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Maqu_3352
  Exosomal proteins of bladder cancer cells
   Maqu_3352
  Exosomal proteins of melanoma cells
   Maqu_3352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM20423
UniProt: A1U604
Position
complement(3707100..3707858)
Genome map
AA seq 252 aa AA seqDB search
MRRRIVAGNWKMNGSKDLVKQLVGAVREQSGSVGEDVEVVIIPPAIYLDQVAEQGGGRIT
TGAQNVSQWQSGAYTGEISAEMARDMGCGYVLVGHSERRQLFGETDSVAAAKVEQVLLSG
LVAVLCVGETLAEREADQAEAVVAEQVRSGLSVVADGQWSRVVVAYEPVWAIGTGKTATA
DDAQAMHSEIRKVLDGMNAPANEISVLYGGSVKADNAAALFAEPDIDGGLIGGASLKAEE
FISICRSFPAGV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcagaattgttgccggaaactggaaaatgaacgggtcgaaagatctggtgaaa
cagctggttggcgcagttcgcgaacagtccggcagtgttggcgaagatgtggaggtggtt
attatccctcctgcgatctatctggaccaggttgccgagcagggaggtggacggatcact
accggtgcgcagaacgtgtcccagtggcaatctggcgcatataccggagaaatctccgcc
gaaatggcccgcgatatgggttgtggctatgtgctggtgggtcattccgagcgccggcag
ctgtttggtgagacggattctgtggcagccgccaaggttgaacaggttctgttgagtggc
ttggttgcggtgctgtgtgtaggtgaaacgctcgcggagcgggaagccgatcaagccgaa
gcagtggttgccgagcaggttcgcagtgggttgtcagttgtggctgatggtcagtggtcc
agggttgttgtggcgtatgagccggtctgggctatcggaaccggaaaaaccgcgacggca
gacgatgcccaggccatgcattcggaaatccgcaaggtgctggatggtatgaatgcaccg
gctaatgagatttcggtactttacggcggcagtgtaaaagcggataatgcggccgctttg
tttgcagagccggatattgatggcggtctcatcggtggtgcatcgttgaaggccgaagaa
tttatcagcatttgccggtctttcccggcaggtgtctaa

DBGET integrated database retrieval system