KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3721Help
Entry
Maqu_3721         CDS       T00454                                 

Definition
(GenBank) ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
KEGG Orthology (KO) [BR:maq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:maq02044]
    Maqu_3721
Secretion system [BR:maq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Maqu_3721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N TPR_16
Motif
Other DBs
NCBI-ProteinID: ABM20790
UniProt: A1U721
Position
complement(4129370..4130818)
Genome map
AA seq 482 aa AA seqDB search
MQVIEQHPYVDQVLNPIPGDTGVGESLAEDSTLEFLEDEIMKVGSLAHNDIDWHKVESEA
LKLLADRSKDIKVLGFVMLSLQRGGDGERFALSLYLLHRVLDDWWENAWPYPGAKGQRAR
KMLFTQMLQRALKAVESLNFDASVGDGRQFCLDLVEKLDTQAKDRDLPDDALFDLKRAVE
KLPKPDQATAPRTASENTPTNKRETTASSSPSSSASSNTTAASLGNLTLDPSNERATRQS
LLKVAELLTGSEPDNALGYRMRRYAIWQSITSLPPTRDGKRTDLAAVSADRVAEYKEALE
KTPDLELWQRIEQSLSVSPFWLDGHWLSARAAMALGNTDCAEAIREALKAFVDRLPQLAE
LTFNDGTPFLSDDGADWLHTAPAAGKGTGAGANPWEQAFDGALELVRQNKLAPAMELLEQ
GLADAREPRERFYWRLATARLLKETGLKALAAEQIQDLKNQIQGRVLDDWEPALIKQLER
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgattgaacagcatccgtacgtggatcaggtactgaacccgatcccgggtgac
accggggtaggcgaaagcctggctgaagacagcacgctggagtttctcgaagacgagatc
atgaaagtgggctcgctggcccacaacgacatcgactggcacaaggttgaaagcgaagca
ctgaaactgctggcggatcgcagcaaggacatcaaggttctgggttttgtcatgctcagc
ctgcaacgtggcggcgatggtgaacggtttgccctgtcgctgtacctgctgcatcgggtg
ctggacgactggtgggaaaacgcgtggccctatcccggtgccaaggggcagcgggctcgc
aagatgctgtttacgcagatgctgcagcgggcccttaaagcggttgagagcctgaacttt
gatgccagcgtaggagatggtcgtcagttctgtctggatctggttgagaaactggatacc
caggccaaagaccgggatttacctgacgacgccctgttcgacctgaagcgggccgtggaa
aagctgcccaagccggaccaggccaccgcgccccggacggcgtctgaaaacaccccgaca
aacaaacgggagaccacggccagctcatcgccctccagctcggccagttccaacactacg
gccgcgtcgctgggcaacctgacactggacccgagtaatgagcgtgcgacccgacagagt
ctgctcaaggtcgccgaactgctgaccggcagcgaaccggacaacgccctgggctaccgg
atgcgtcggtatgccatctggcagagtatcaccagcctgccgccaacccgggatggcaag
cgcacagatctggcagccgtcagcgccgaccgggtggccgagtacaaggaagctctggag
aaaacaccggacctggaactgtggcagcgcattgaacaaagcctgtcggtcagcccgttc
tggctcgatggccactggctcagcgcccgggcggccatggcccttggcaataccgattgc
gcggaggccatccgggaagccctgaaagcgtttgtcgaccgcctgccgcaactggccgag
ctcaccttcaacgatggcacaccgtttctcagtgacgatggcgcagattggttgcacaca
gccccggcggctggcaaaggaacgggcgcaggtgccaatccctgggagcaggcattcgac
ggtgcgcttgagctggtgcggcagaacaaactggcgccggccatggaactgctggaacag
ggtctggccgatgcccgggagccgcgcgagcgcttctactggcgcctggctacggcccgg
ctgctcaaggaaaccggcctgaaagccctggccgccgaacagattcaggatctgaaaaac
cagatccaggggcgggttctcgatgactgggaaccggctcttataaaacaactggaacga
ctggcgtaa

DBGET integrated database retrieval system