KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3724Help
Entry
Maqu_3724         CDS       T00454                                 

Definition
(GenBank) ATPase AAA-2 domain protein
  KO
K11907  type VI secretion system protein VasG
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:maq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Maqu_3724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:maq02044]
    Maqu_3724
Secretion system [BR:maq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Maqu_3724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 AAA_7 TniB NACHT AAA_18 Sigma54_activat Clp_N AAA_25 Rad17 SRP54 AAA_6 Fzo_mitofusin
Motif
Other DBs
NCBI-ProteinID: ABM20793
UniProt: A1U724
Position
complement(4133204..4135891)
Genome map
AA seq 895 aa AA seqDB search
MCSAFWNNYRNKDITVIRVELPALIGRLNDISRQALEASAALCISRQGAEITPAHLLFKL
LETPFSDVRQILEHTGINHQQLQPVVGDSLNGEPQTAEPYPSFSPLLVELMQDAWLLAST
ELGHTELRSGAVFLALLMNADRYLMPRVAQALVDINREQLRKQFDRVTEGSVERPQLMES
GGAKRAVEADMDPLKRYATDFTKLAREDKLDPVVCRDAEIDQMIDILCRRRKNNPIVVGD
AGVGKSAVVEGLALRIVNGDVPDRLKNVELWTLDMGALQAGASVKGEFEKRLKGVIEAVK
GSATPIILFIDEAHTLIGAGNSEGGSDAANLLKPALARGELRTIAATTWREYKKYFEKDP
ALSRRFQPVALDEPTPGEAVHILRGLRTVYEKAHQVLIADSALKAAAEMSARYLAGRQLP
DKAIDVLDTACARVSLNLSTPPRRLSHVRSELHQLAMEQELLSREHTLGQNVDAEREQTL
EQKIADLTAESSTLEQSWNDQRELVARLVEIREQLLAGDVEGETADDAAVEMAESDHEER
PDLKSEAAAIEQELAELQADEPLVHARVDARQVAEVIADWTGIPVNRMTTDELEKITHLP
AYLQAHIKGQDTAIDCLHQHLLTARADLRRPGRPMGAFLLVGPSGVGKTETVVQLAELLY
GGRQFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGILTEAIRQKPYSVVLLDEVEKAH
PEVLNLFYQAFDKGELADGEGRLIDCKNVVFFLTSNLGFQTIVNHAEEPEKIEEALYPEL
ANFFKPALLARMEVVPYLPLGEDTLNRIVGDKLQRLADQIQTRYHTEVELEDGLVEAIRS
RATRSENGARMLESIIEGELLPPVSLALLEKLAAREPVTKVTLGVTENKFTGTVA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcagcgttctggaacaactaccgaaataaggacatcactgtgattcgggtagaa
ctgccggcgctgatcgggcgccttaacgacatttcacgccaggctctggaggcctccgcg
gccctgtgcatcagccgtcagggcgccgagattaccccggcgcacctgctgttcaaactg
ctggaaacgccgttctcggatgttcgccagatcctcgaacacaccggcatcaaccaccag
caactgcaacccgtggtgggtgacagcctgaacggcgaacctcagaccgccgaaccgtat
ccgtcgttctcgccgctgctggtagaactgatgcaggacgcctggctgctggcctcgacc
gaactcggccataccgaactgcgttccggcgcggtgttcctggccctgctgatgaacgcc
gatcgctacctgatgccccgggtggcgcaggcgctggtggacatcaaccgggaacagctg
cgcaagcagtttgatcgggtaaccgagggttctgtggagcgtccgcagctgatggaaagc
ggtggtgccaagcgagcggttgaagccgatatggacccactcaaacgttacgccaccgac
ttcaccaagctggcccgggaagacaaactggaccccgtggtgtgtcgcgatgccgagatc
gatcagatgatcgatatcctctgccgtcgccgcaagaacaaccccatcgtggtgggcgac
gctggcgtgggcaaaagcgccgtggtggagggcctggccctgcgcattgttaacggcgac
gtgccggaccggctgaagaacgtcgaactctggaccctggacatgggtgccctgcaggcc
ggtgcctcggtgaagggcgagtttgaaaaacgcctgaagggcgtgatcgaagccgtgaaa
ggttcggcgaccccgatcatcctgttcatcgacgaagctcacaccctgatcggtgcgggt
aacagcgaaggtggctccgacgctgccaacctgctgaagccagccctggcccgtggcgaa
ctgcgcaccatcgctgccaccacctggcgcgagtacaagaaatacttcgaaaaagacccg
gctctcagccgccggttccaaccggtggccctggacgagccaacgccgggcgaagcagtc
cacatcctccgtggcctgcgcacggtctacgaaaaagcccatcaggtactgatcgccgac
agcgcccttaaagccgccgcagaaatgtccgcccgttacctggccggtcgccagctgccg
gacaaggccatcgatgttctcgataccgcctgcgcccgggtcagcctgaacctgagtaca
ccgccacgccgtctcagccatgtgcgcagtgagctgcaccagttggccatggagcaggag
cttctgagccgggaacacacgcttggccagaacgtggatgccgagcgcgaacagaccctg
gaacagaagattgccgacctgaccgccgaatccagcacgctggaacaaagctggaatgac
cagcgcgaactggtggcccgcctggtcgagatccgtgaacagctgttggcgggggatgtc
gagggcgaaaccgcggatgacgctgctgttgagatggccgagagcgatcacgaagaacgc
ccggacctgaaaagcgaagccgccgccatcgaacaggaactggctgaactccaggccgac
gaaccgttggtacacgcccgggtggatgcccgccaggtggccgaagtcatcgccgactgg
accggcatcccggtcaaccgcatgaccaccgacgagctggaaaaaatcacccacctgccg
gcgtacctgcaggcccacatcaaaggccaggacacggccatcgactgcctgcatcagcac
ctgctcaccgcccgcgccgacttgcgccggccgggtcgccccatgggcgccttcctgctg
gtaggccccagtggtgtgggcaaaaccgaaaccgtggtgcaactggctgaactgctctac
ggcggccgccagttcctcaccaccatcaacatgtccgaataccaggagaaacacaccgtc
tcccgcctgatcggctcgcccccaggctacgtcggattcggcgaaggcggcatcctcacc
gaagccatccgccagaagccttattccgtggtgctgctcgacgaagtcgaaaaagcccac
ccggaagtgcttaacctgttctaccaggctttcgacaaaggcgaactggccgacggtgaa
ggccggttgatcgactgcaagaacgtggtcttcttcctgacctccaacctcggcttccag
accatcgtcaaccacgccgaagagccggagaagatcgaagaagccctgtacccggaactg
gccaacttcttcaagccggcattgctggcgcggatggaagtggtgccctacctgccgctg
ggtgaagacactctcaaccgcatcgtcggcgacaaactccagcgcctggctgaccagatt
caaactcgttaccacaccgaggtggaactggaagacggcctggtcgaagccatccgcagc
cgcgctaccagaagtgaaaacggcgcgcggatgctggagtcgatcatcgaaggcgaactg
ctgccaccggtgtcgctggcgctgctggaaaaactggcggccagggagccggtgacgaag
gtgacgcttggggttactgaaaacaagttcacgggcacagtcgcctga

DBGET integrated database retrieval system