KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3730
Entry
Maqu_3730         CDS       T00454                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
KEGG Orthology (KO) [BR:maq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:maq02044]
    Maqu_3730
Secretion system [BR:maq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Maqu_3730
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABM20799
UniProt: A1U730
Position
complement(4140854..4142626)
AA seq 590 aa
MKLNRFYRDELSFLRLQGREFAEAHPQLTRFLSEQSTDPDVERLLEGFAFLTGKLREKVE
DEFPELTHSLLNMLWPNYLRPVPSCTIMRFDPQLHAISERQVVDRHTEIKSRPLGDASRQ
TQCRFRTCRSVDIFPISVADANAEHSREVSSVTVDLALHTDQPLNGIGLENLRFYLGGDN
HTAETLYLWLNHYLSRMELVVGDRVVSLPSSLLQPVGFAADEAILPYPKNAYAGYRIIQE
YLSFPEAFRFVDITGLKSRLPAVQADEISLRFHFSRILPPDTRVTRDSMQLYCTPAVNLF
SHEGEPVDLNGRQTEYRISPSSRCPEHYEVFSIEQVEGWLEGRSGRGEPRIYTAFESFQH
EVERDRGRTALYYRVRTRESVRGDGFDHYISFVRGDETECLNRQEAVSLTLTCTNRQLPQ
QLAVGEVCMATESTPAFAAFSNITRPTATLRPTLDGSLLWTLISNLSLNYLSMLDVDALR
TVLRVYDFRALVDRQAERVSQKRLAGITGITTKPVDRMIRGLPVRGIRSELQLDQHGFAS
EGDLYLFGTVLSQFFALYASINAFHQLEVVNTDNQERYTWTLQQGQQPLM
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaagttaaacaggttctacagggatgagttgagctttctgcggttgcaaggcagggaa
tttgccgaagcccacccgcagctcacccgctttctatccgaacagagcaccgacccggac
gtagaacggcttctggaaggcttcgccttcctgaccggcaaactgcgggaaaaagttgag
gacgagtttccggagctgactcattcgctgctgaacatgctctggcccaattatctgagg
ccagtgcccagctgcaccatcatgcgctttgatccacagctgcatgccatcagtgaacgt
caggttgttgatcgtcataccgagatcaagagccgccccctgggcgacgccagccgccag
acccaatgccggttccgcacctgccggtcggtggatatttttccgatcagtgtggccgat
gccaatgccgagcactcacgggaagtttcctccgtgaccgtagacctggccctgcatacg
gaccagccactgaatggcattggcctggaaaatctgcgtttttacctggggggcgacaac
cacacggcagagaccctgtatctgtggttaaaccattacctcagccgtatggagctggtg
gtgggcgaccgtgtggtcagtctgccttcatccctgttgcagccggttggctttgcggca
gatgaggcgatcctgccttaccccaagaatgcttatgccggctaccggattatccaggag
tacctgagttttccggaggccttccggtttgttgatatcaccggcctgaaatcccgattg
ccagcggtgcaggctgatgagatcagtctgcgtttccacttcagccggattttgcccccg
gacacccgggtaacccgcgactccatgcagttgtactgcacccccgcggttaatctgttc
agccacgaaggcgagccggtagacctgaacggtcgccagactgaataccgtatttcaccc
tccagccgctgcccggaacactacgaggtgttcagtatcgagcaggttgagggctggctg
gaaggtcgttccggtagaggcgagccgcgcatctacacggcgttcgagagtttccagcat
gaagtggagcgagatcgcggccgtaccgccctgtactaccgggtacgtacccgggagagc
gtgcgtggtgatggttttgatcactacatttcctttgttcgcggtgatgaaaccgaatgt
ctgaatcgtcaggaagcggtctcgctcacgctcacctgcaccaatcgccagttgccacaa
caactggccgtcggggaagtgtgcatggccaccgagagcacaccggcctttgccgcattc
agcaatatcacgcgcccgacggcgaccctgcggcctaccctggatggcagcctgttgtgg
acgctgatatccaacctgtcattgaactacctgtcgatgctggatgtggatgccctgcgc
accgtgctgcgagtgtatgacttccgggccctcgtcgaccgacaggctgagcgggtgtcc
cagaagcggctggccggtatcacgggcatcaccaccaagccggttgaccgcatgattcgc
gggctgccggtgcgcggtatccgctcagagctgcagctggatcagcatgggtttgccagt
gaaggtgacctctacctgttcggcacggtgttgagccagttttttgcgctttacgcgagt
atcaatgcgtttcaccaactggaagtggtgaatacagacaatcaggaacggtacacatgg
acgttacagcaaggtcagcagccgctgatgtag

DBGET integrated database retrieval system