KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3733
Entry
Maqu_3733         CDS       T00454                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
KEGG Orthology (KO) [BR:maq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:maq02044]
    Maqu_3733
Secretion system [BR:maq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Maqu_3733
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABM20802
UniProt: A1U733
Position
complement(4144909..4145406)
AA seq 165 aa
MSAKDGSVAPKERINIKYVPATGDQQAETELPLKMFVVGDFKGHAEETPIEDRKAISVDK
NNFRSVMKEAGLTLSTSVSNKLEDGADDLPVNLEFQGLEDFSPDSIARQVPELKKLIELR
EALVALKGPLGNVPSFRSKLQELLDNDDAREKLLAELELATDGGE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtctgccaaagacggttccgttgcgccgaaagagcgcatcaatatcaagtatgtcccc
gccacaggcgatcagcaggccgaaaccgaactaccactgaagatgttcgtggttggtgat
ttcaagggtcacgctgaagaaacccccattgaagaccgtaaggccatttccgtcgacaag
aacaacttccgttctgtcatgaaggaagcgggtctgacgctttccaccagtgtttccaac
aagctcgaagacggtgccgacgacctccccgtgaatctcgaattccaggggctcgaagac
ttttctccggacagcattgcccgccaggtccctgagctcaagaagctgattgagctgcgt
gaagccctggttgccctcaagggcccgctgggcaacgtgccttcgttccgttccaagctg
caggagctgctggacaacgacgacgcccgggaaaagctgttggctgaacttgagctggcc
accgacggcggcgagtaa

DBGET integrated database retrieval system