KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3930
Entry
Maqu_3930         CDS       T00454                                 

Definition
(GenBank) putative exported protein
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ABM21210
UniProt: A1U891
Position
pMAQU02:complement(33142..33807)
AA seq 221 aa
MGRTKKALDGRDSHILTLRILLGLLSVALILTIMGWRDAPEHIKVDIPPDLRSGSTRGID
ERHPFNIYAFGYYIWQQMNNWPVEGTDNYKQQIERLSCYITPRFKGELERDYQQRLLNHE
LTRSRALQEMPDRPYTAKRVYVESGDSWVAFYDVNVKETFRSEIVKDIFVRYPLRVVRWD
VDPECNLWGLALDGFYKKPRRLEGGSREQDDVQNTSSEIGE
NT seq 666 nt   +upstreamnt  +downstreamnt
atggggcgtacaaaaaaagctctcgatggtcgcgattcgcacattctgaccctacgaata
ctgctcggacttttaagtgtcgcactgattcttacgatcatgggatggagggatgcaccc
gagcacatcaaagtggatataccgcccgatcttcgttctggctctacccgaggaatcgac
gaacggcatccattcaatatttatgcgtttggctactacatctggcaacagatgaacaat
tggccagttgaaggcaccgataactataaacaacagatcgagcgcctgagctgctacatc
actccacgatttaagggtgaactggagcgggattatcagcagcgccttttaaaccacgag
ctcacccgctctcgcgcacttcaggaaatgccggatcgcccgtacacggccaaacgagtc
tatgtggaatctggagacagttgggtggcgttctacgacgtcaacgtaaaagagacgttt
cgttccgagatcgtcaaagacatttttgttcgatacccccttcgagtcgtgcgctgggat
gtggatcccgagtgcaatctgtggggcctggcgcttgacggtttctataaaaaaccgagg
cgactggaaggcggcagccgggagcaggatgacgttcagaacacctcttcggaaatcggt
gaataa

DBGET integrated database retrieval system