KEGG   Marinobacter nauticus VT8: Maqu_3936
Entry
Maqu_3936         CDS       T00454                                 
Name
(GenBank) conserved hypothetical protein
Organism
maq  Marinobacter nauticus VT8
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ABM21215
UniProt: A1U896
Position
pMAQU02:complement(37921..38649)
AA seq 242 aa
MAEASTEHPARRRGPIGKTIELVLKIIGLLLFSAFMSVVIEWVGMAFFYDEPGYAHAESM
MQTEIGYLSESLTGGDGMNEGAISSASETVSTVANFLFIDSGIVDNLQAVKTVSPDDGEI
KAAVKRLVAGYYDYLMAAVYVLIMFLVRMAILFLSMPAFILFGIVGISDGLMQRDLRRWC
GGNESGYVYHWAKRFSLPVLALAWILYLSIPNSIHPNFIITPFAVLFGLCLMVMTSKFKK
YL
NT seq 729 nt   +upstreamnt  +downstreamnt
atggctgaggcgagcactgaacacccggcccggcggcgagggcccataggcaagacgatt
gagctggttctcaaaataatcggattgctccttttttctgcctttatgtccgtagtaatc
gagtgggtcggtatggcgtttttctacgacgagccaggatacgcccacgccgagtccatg
atgcaaacggagattgggtatttgagcgagtccctgacaggcggggacggcatgaatgaa
ggtgcgatttcatcggccagtgaaaccgtaagtaccgtagcgaattttctttttatcgat
tcaggtattgtcgacaatcttcaagcggtaaaaacggtgtctccggatgacggtgagatc
aaggctgcagtaaagaggctagtagcaggatattacgactacctcatggcggcagtttac
gttctgatcatgttcctggttcgaatggccattctctttctgtcgatgccggctttcata
ctgttcggcattgtagggatcagcgatggactgatgcagcgggatcttcggcgctggtgt
ggcgggaatgaatccgggtatgtctatcactgggcaaaacgattctccctaccggtattg
gccctcgcctggattctctacctgtcgattccaaattcgatccatccgaactttattatc
acgccgtttgcggttctttttgggctttgtctgatggtcatgacctcgaagttcaaaaag
tatctttga

DBGET integrated database retrieval system