KEGG   Marinobacter nauticus VT8: Maqu_3937
Entry
Maqu_3937         CDS       T00454                                 
Name
(GenBank) conserved hypothetical protein
Organism
maq  Marinobacter nauticus VT8
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 GFRP AAA_22
Other DBs
NCBI-ProteinID: ABM21216
UniProt: A1U897
Position
pMAQU02:complement(38653..40647)
AA seq 664 aa
MSVSIGAAGICLLSPSTLMMTPSVGYTSAAVLTAFAVYRFIQGTRVTRYQRNLKRLPRFE
MSSRQIPCYRQHLYLGQGFRWGQHHTQRLKDTMAPAFAKYTRPSRINAWFREFERRIEHT
RLGFLAELTSKDHPLNPVRPYPAVGGNPAIHAVELNEKEVLLAMSERVGHTLCMGTTRVG
KSRLAEILIEQDIRRNEGPVIVFDPKSDPGLLTRMYMAAKRTGRTDDFYMFHLGFPEISA
RYNAIGNFSRITEIAGRISGQLSSEGNSAAFKEFAWRFINIVARALVSLGMRPDYNNILR
YVTDIEPLFNQYLDWWLPMNGDEGWMEDINAMTADAERQYRSNPRMAKHANPRTEALRKY
VEQMQVSDPILHGLLSALRYDKTYFDKLVASLLPLLEKLTTGRIGKLLAPDYFDVDDDRP
IFDWTQIIRKRGIVYIGLDAMTDTEISSAVGNSMFSDLVSVCGSIYKHGFEHGMLEGKAN
VMPKVCLHADEFNELMGDEFLPMVNKSGGSGMQITAYTQSRGDIEARLGNTAKARQVEGN
FNNLIMLRVKEKETAELLTNQLPEVEIAQIMTVSGASDSSDTESSVDFTSNTQDRISMLR
VPMLEPGHITSLPKGQAFCLLDGGQLWKVRFPLPVEDDEDMPENLQALTREMDKNYHTAE
NWWA
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgagtgtcagcattggtgcagccgggatctgcctgctatcaccctccacattgatgatg
acaccgagtgttggctacacctcggcggcggtattaaccgcgttcgctgtataccgcttc
attcagggaacacgggttacccgatatcagcgcaacctcaagcgtctgccacgatttgag
atgtcatcgcgccagattccttgctatcggcaacacctctatttggggcaggggtttcgc
tggggccagcaccatacccagcgcttgaaagatacgatggctccagcattcgccaaatac
acgaggccgtcccgaatcaacgcctggtttcgggaatttgagagaagaatagagcacacc
agattaggcttccttgcggaactgaccagtaaagatcatccactgaatcccgtgcgacct
tacccggctgtcggcgggaatccggccatccatgcggttgaactcaacgaaaaagaagtg
cttctggccatgtcagagcgcgtcggtcacaccctttgcatgggaacgacccgagtcggt
aagagccgcctcgccgaaattctgattgagcaggacattcgccgtaacgaagggcccgtc
atcgtattcgacccaaagtcagaccctgggcttttgaccaggatgtatatggcggcgaag
cgaacaggaagaacagacgatttttacatgtttcacctcggtttcccggagatcagtgct
cgttacaacgctatcggtaacttttcgcgtatcactgaaattgccggccgcatttctggt
cagctgtcgtctgaaggaaacagtgctgctttcaaggagtttgcgtggcgcttcattaat
attgtcgctcgtgcgcttgtttccctgggaatgcgcccggactacaacaacattctccgg
tacgtgacggacattgagcctcttttcaatcagtacctggattggtggctgccaatgaac
ggtgatgaaggctggatggaagacatcaatgcgatgaccgctgatgccgaacggcaatac
agatccaatccccgcatggctaaacatgccaatccgcgaaccgaggctttaaggaaatac
gttgagcaaatgcaggtgagtgatccgatcctgcacggactgctttcagccttacgctac
gacaaaacgtacttcgacaagctggtagcgagtcttttgccccttcttgagaagctcacc
acaggcagaattggcaagctactggcacccgactacttcgatgtcgacgatgaccggccg
attttcgactggacgcagatcattcgtaagcgaggtattgtctatataggtctggatgcc
atgacggacacagaaatctcctcagccgttggcaactcaatgttctcagacctggtcagc
gtctgtggatctatctataagcacggcttcgaacatggaatgctcgaaggcaaggcgaac
gttatgcccaaagtatgcttacatgcagacgagttcaatgaactgatgggggacgaattc
ctccccatggtcaataaatcgggcggtagcggcatgcaaattaccgcctatacgcagtcc
cggggcgacatcgaggctcgtttggggaataccgcgaaggcccgccaggtggaaggcaac
ttcaacaacctgattatgctgcgggtcaaggaaaaggaaacagctgagctgctcaccaat
caactgcctgaagttgaaattgcgcagatcatgacggtatctggcgcgagtgattcctca
gacaccgagtccagtgtggacttcacgtctaatacccaggaccggatctcaatgctccgt
gtaccgatgctggagcccggacacataacctcattgccaaaagggcaggctttttgcctg
ttggatggcggtcaactctggaaagttagatttccgctgcccgtggaagatgatgaagac
atgcccgagaatcttcaggcgctcacccgggaaatggataaaaactatcacacggcggaa
aattggtgggcatga

DBGET integrated database retrieval system