KEGG   Methylobacterium aquaticum: Maq22A_1p33720Help
Entry
Maq22A_1p33720    CDS       T04311                                 

Gene name
paaJ
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00071  Fatty acid degradation
maqu00072  Synthesis and degradation of ketone bodies
maqu00280  Valine, leucine and isoleucine degradation
maqu00310  Lysine degradation
maqu00362  Benzoate degradation
maqu00380  Tryptophan metabolism
maqu00620  Pyruvate metabolism
maqu00630  Glyoxylate and dicarboxylate metabolism
maqu00640  Propanoate metabolism
maqu00650  Butanoate metabolism
maqu00900  Terpenoid backbone biosynthesis
maqu01100  Metabolic pathways
maqu01110  Biosynthesis of secondary metabolites
maqu01120  Microbial metabolism in diverse environments
maqu01130  Biosynthesis of antibiotics
maqu01200  Carbon metabolism
maqu01212  Fatty acid metabolism
maqu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Maq22A_1p33720 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    Maq22A_1p33720 (paaJ)
   00640 Propanoate metabolism
    Maq22A_1p33720 (paaJ)
   00650 Butanoate metabolism
    Maq22A_1p33720 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Maq22A_1p33720 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    Maq22A_1p33720 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maq22A_1p33720 (paaJ)
   00310 Lysine degradation
    Maq22A_1p33720 (paaJ)
   00380 Tryptophan metabolism
    Maq22A_1p33720 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Maq22A_1p33720 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Maq22A_1p33720 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Maq22A_1p33720 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maqu04147]
    Maq22A_1p33720 (paaJ)
Enzymes [BR:maqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Maq22A_1p33720 (paaJ)
Exosome [BR:maqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Maq22A_1p33720 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: BAQ49033
UniProt: A0A0C6FKP6
Position
pMaq22A_1p:complement(768697..770220)
Genome map
AA seq 507 aa AA seqDB search
MTDPARIPVIVGIGEITDRADAADRGPIGAEPAGLMAEALRRADGDAGGGWLPRIASLDV
VNAVSWPYADLPACVAALLDHRPAHLAYGPVGGETPVRFLHEAARRIARGEVAVAALCSG
EAEHSAGAARRAGLDPARDATPPWTVPDPAWTNPRARDYLHPQALRHGLSQPVVVYPLYE
IALQAAWGQTPRRGRDESAALWAGMSRVAAENPHGWLRRSFAPDEIATPTPANRPIAWPY
TKLMVANPVVNQAAALIVTSLGLARAAGIPEHRLVPIGPGAAASEPRDWLSRDRFDHAPA
QDAVLEATLRRAGLAASDLTAIELYSCFPCVPKMARRRLGLPADAVSTVAGGLTFFGAPL
NGYMAHAACAMVRRLRDAPGRAGLLYGQGEFVTKHHALVLGGRFDGPDDAPVSVQDEADR
RRGPVPPVAEEAAGRAVIETHTVLFDREGAPERGVVVLRQNQTRLLARVPAADRATLAAL
TDLDRSPVGLAGPLRRGRDGLLEWEAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggcccgcatcccggtcatcgtcggcatcggcgagatcacggaccgggcc
gacgcggcggatcgcggcccgatcggcgccgagcccgccggcctgatggccgaggccctg
cgccgggcagacggcgatgccggcggcggctggctcccgcggattgcctccctcgacgtc
gtcaacgcggtgtcctggccctatgccgacctgccggcctgcgtcgccgcgctcctcgac
caccgcccggcgcacctcgcctacggcccggtcggcggcgagacgcctgtgcgcttcctg
cacgaggcggcgcggcggatcgcacgcggcgaggtcgcggtggcggccctgtgcagcggc
gaggccgagcacagcgcgggcgcggcgcggcgcgccggcctcgatcccgcccgggatgcc
accccaccctggaccgtgccggaccccgcctggaccaacccgcgggcgcgcgactacctc
catccccaggccctgcgccacggcctgtcgcaaccggtcgtcgtctaccccctgtacgag
atcgcgctccaggccgcctggggtcagaccccgcgccggggccgcgacgaatcggcggct
ctgtgggccggcatgtcccgggtcgccgccgagaacccccacggctggctgcgccggtcc
ttcgcccccgacgagatcgccacgcccacgcccgccaaccggccgatcgcctggccctac
accaagctgatggtcgccaaccccgtggtgaaccaggccgcggccctgatcgtgacgagt
ctcggcctcgcccgcgccgccggtatcccggagcaccgtctggtcccgatcggccccggc
gcggccgcgagcgagccgcgggactggctgtcgcgcgaccgcttcgaccacgccccggcg
caggacgcggtgctggaggcgacgctccgccgggccgggctcgcggcctctgatctcacg
gcgatcgagctctacagctgctttccgtgcgtgcccaagatggcgcgccgccgtctcggc
ctgcccgcggacgcagtgtcgacggtggcgggcgggctgaccttcttcggcgcgccgctc
aacggctacatggcgcatgccgcctgcgcgatggtccgccgcctgcgcgacgcgcccggc
cgcgccggactgctctacggccagggcgagttcgtcaccaagcaccacgccctggtgctg
ggtggccggttcgacgggcccgacgacgcgccggtctccgtccaggacgaggcggatcgc
cgccgcgggccggtgccgccggtggcggaagaggccgcgggccgcgccgtgatcgagacc
catacggtgctgttcgaccgcgagggcgcccccgagcggggcgtcgtggtgctgcgccag
aaccaaacgcgcctgctcgcccgggtgccggccgccgaccgcgccaccctggcggcgctg
accgatctcgaccgctcgcccgtcggcctcgccggccccctgcgccgagggcgcgacgga
ctcctcgaatgggaggccgcctga

DBGET integrated database retrieval system