KEGG   Methylobacterium aquaticum: Maq22A_c01695Help
Entry
Maq22A_c01695     CDS       T04311                                 

Gene name
nifH
Definition
(GenBank) protochlorophyllide oxidoreductase
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00860  Porphyrin and chlorophyll metabolism
maqu01100  Metabolic pathways
maqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Maq22A_c01695 (nifH)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Maq22A_c01695 (nifH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MipZ MeaB AAA_16 AAA_25 CBP_BcsQ AAA_10 SRP54
Motif
Other DBs
NCBI-ProteinID: BAQ43835
UniProt: A0A0C6FMQ1
Position
341260..342153
Genome map
AA seq 297 aa AA seqDB search
MNIAIRNPVPARREEGSLQVALDPDIRIETAKVFAVYGKGGIGKSTTSSNLSVAFSKLGK
RVLQIGCDPKHDSTFTLTKRLAPTVIDALEAVQFHSEELRVEDFVVEGYNGVRCVEAGGP
PAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFASPLQHADRALIVTAND
FDSIFAMNRIVAAIHAKSKNYGVRLGGVIANRSAKTDEIDRFNDAVGLKRLAHFRDLDVV
RRSRLKKATLFEMDPSPELLAVQAEYLQLAEQLWAGVDPLPAVPMKDRDLFEFLGFD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgcgatccgaaaccccgtccccgcccgacgggaagagggaagcctccaggtc
gccctcgatccggacatccgcatcgagaccgccaaggtcttcgccgtctacggcaagggc
ggcatcggcaagagcacgacctcgtcgaacctctccgtcgcgttctcgaagctcggcaag
cgcgtcctgcagatcggctgcgaccccaagcacgattcgaccttcacgctgacgaagcgc
ctggcgcccaccgtcatcgatgccctggaggcggtgcagttccattcggaggaactgcgc
gtcgaggacttcgtggtcgagggatacaacggcgtgcgctgcgtcgaggcgggaggcccg
ccggccggcaccggctgcggcggctacgtcgtcgggcagacggtgaagctcctgaaggag
caccacctcctggaagataccgacgtggtgatcttcgacgtcctcggcgacgtcgtctgc
ggcggcttcgcctcgccgctccagcacgccgaccgggcgctgatcgtcacggcgaacgac
ttcgattcgatcttcgcgatgaaccggatcgtcgcggcgatccacgccaagtcgaagaat
tacggcgtgcgcctcggcggcgtcatcgccaaccgctcggcgaagaccgacgagatcgac
cgcttcaacgacgcggtgggcttgaagcgcctggcgcatttccgggatctcgacgtggtg
cgccgctcgcgcctgaagaaggcgacgctgttcgagatggatccctcgccggaactgctc
gccgtgcaggcggagtacctgcaactcgccgaacagctctgggccggtgtcgatccgctt
ccggcggtgccgatgaaggatcgggacctcttcgaatttctcgggttcgactga

DBGET integrated database retrieval system