KEGG   Methylobacterium aquaticum: Maq22A_c17105Help
Entry
Maq22A_c17105     CDS       T04311                                 

Gene name
atoA
Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00072  Synthesis and degradation of ketone bodies
maqu00280  Valine, leucine and isoleucine degradation
maqu00650  Butanoate metabolism
maqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Maq22A_c17105 (atoA)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Maq22A_c17105 (atoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maq22A_c17105 (atoA)
Enzymes [BR:maqu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Maq22A_c17105 (atoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: BAQ46540
UniProt: A0A0C6FU18
Position
3287437..3288102
Genome map
AA seq 221 aa AA seqDB search
MAWTRDQMAARAARELEDGFYVNLGIGIPTLVSNYIPDGMSVQLQSENGMLGMGPFPYEG
EEDPDLINAGKQTITELPTTSYFSSADSFGMIRGGHIDLSILGAMQVAQNGDLANWMIPG
KMVKGMGGAMDLVAGVKKVVVVMEHVAKAKDGSESPKLLEACDLPLTGTHVVDMVITDLG
VFTIDKKGDGGMSLVELADGVTEDEVRAKTQGQYRVALKNG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacccgcgaccagatggccgcccgcgccgcccgcgagctcgaggacggcttc
tacgtcaatctcggcatcggcatcccgacgctggtgtcgaactacatccccgacggcatg
tcggtgcagctccagtccgagaacgggatgctgggcatgggcccgttcccctacgagggc
gaggaggatcccgacctcatcaatgccggcaagcagaccattacggagttgccgaccacg
agctacttctcgtcggccgattcgttcgggatgatccgcggcgggcacatcgacctgtcg
atcctcggcgcgatgcaggtggcccagaacggcgacctcgccaactggatgatccccggc
aagatggtgaaggggatgggcggcgcgatggacctcgtcgccggcgtcaagaaggtcgtc
gtggtgatggagcacgtcgccaaggccaaggacggctcggaatcgccgaagctgctcgag
gcctgcgacctgccgctcaccggcacccacgtcgtcgacatggtgatcaccgatctcggc
gtcttcaccatcgacaagaagggtgacggcggcatgagcctggtcgagctcgccgacggc
gtcaccgaggacgaggtgcgggccaagacgcaaggccagtaccgggtggcgctgaagaac
ggctga

DBGET integrated database retrieval system