KEGG   Methylobacterium aquaticum: Maq22A_c18495Help
Entry
Maq22A_c18495     CDS       T04311                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase A subunit and related amidases
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00970  Aminoacyl-tRNA biosynthesis
maqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Maq22A_c18495 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:maqu03029]
    Maq22A_c18495 (gatA)
Enzymes [BR:maqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Maq22A_c18495 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Maq22A_c18495 (gatA)
Mitochondrial biogenesis [BR:maqu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Maq22A_c18495 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAQ46787
UniProt: A0A0C6FID2
Position
complement(3564328..3565911)
Genome map
AA seq 527 aa AA seqDB search
MSVSDALIARTILAGTVAEGAPARDLPSAWDRDAPEPAQAERCLRQAAEATGAAAPAPSP
LPPVEAGPLHALGIGALQAAFAAGTTDPVALVAALRERIARHPSGRDAVLAPVPGADDAA
AESARRIRAGEARPLEGIPFGIKDIIDCAGAPVTCGSRLTGERVAEADATVVARLRAAGA
IPLAMLATTEFACGSAHNPRYGAVANPWDRTRWTGGSSTGSGAALAARLMPLALGTDTGG
SIRVPSAWCGVTGLKATRGLVPRTGVAPLSWTLDHVGPMARSAADLARVMPWIAGPDGAD
PHAAGRYDASRARDLAGLRVGVPDGWFTAMQDDAVLAAWEAMLRLLERRGARLVPVDLGA
VATAHQDGYTIVMAELASLQEPDLDRAAALDPGTRARLEQGRLFSAADYLRALRRRPLVL
AQVLDALAEVDVLVTPGLGGEAPSLDTLTVAVNGAAHPLQAVLPRNTMLFDYTGLPALML
PTGRGRTGLPVAAQVVGKPYDDAVCLSVGAAFQRETEYHLVAPREAG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgtcggacgcgctcatcgcccgcaccatcctggccggcacggtggcggaaggc
gccccggcccgggacctgccctcggcctgggaccgggacgcgcccgagccggcccaggcc
gagcggtgcctgcggcaggccgccgaggcgaccggggcggcggcgcccgccccgtcgccc
ctgccgccggtcgaggcgggcccgctccacgccctcgggatcggcgccctccaggccgcc
ttcgcggcggggaccaccgacccggtggcgctcgtcgccgccttgcgggaacgcatcgcc
cgtcacccctccggccgcgacgcggtcctggccccggtgcccggcgcggacgacgcggcg
gcggagagcgcccgccgcatccgggccggggaggctcgccccctcgagggaatcccgttc
ggcatcaaggacatcatcgactgcgccggcgcgcccgtgacctgcggctcgcgcctcacc
ggcgagcgggtggcggaggccgacgcgaccgtggtggcgcggctcagggccgccggggcc
attccgctcgccatgctcgccaccaccgaattcgcctgcggctcggcccacaacccgcgc
tacggcgcggtcgccaacccgtgggaccggacgcgctggaccggcggctcctccaccggc
tccggcgccgcgctcgcggcccggctgatgccgctcgcactcggcaccgacacgggaggg
tcgatccgggtgccgtccgcctggtgcggcgtcaccggcctcaaggccacccgggggctc
gtgccccgcaccggcgtcgcgcccctgtcctggaccctcgaccatgtcggcccgatggcc
cgctcggccgcggacctcgcccgggtgatgccctggatcgccggccccgacggggccgac
ccgcacgccgccggccgctacgacgcctcacgcgcccgggacctcgcgggcctgcgcgtc
ggcgtgccggacggctggttcacggcgatgcaggacgacgcggtgctggccgcctgggag
gcgatgctgcgcctgctggagcgccgcggcgcccgcctcgtgccggtcgatctcggcgcc
gtcgcgaccgcgcaccaggacggctacacgatcgtgatggcggaactggcctcgctccag
gaacccgacctcgaccgcgccgcggcgctcgatcccggcacccgcgcccggctggaacag
ggtcggctcttctccgccgccgactacctgcgcgcgctccgccgccggcccctggtgctg
gcgcaggtgctcgacgcgctcgccgaggtcgacgtgctggtgaccccgggcctcggcggc
gaggcgccgtccctcgacaccctgacggtggcggtgaacggcgcggcccacccgctccag
gcggtgctgccgcgcaacacgatgctgttcgactataccggcctcccggccctgatgctg
ccgaccggccgcggccgcaccgggctgccggtcgccgcgcaggtggtggggaagccgtat
gacgacgctgtgtgcttgagcgtgggggcggcgttccagcgcgagacggagtaccatctg
gtggcgccgcgggaggcggggtga

DBGET integrated database retrieval system