KEGG   Methylobacterium aquaticum: Maq22A_c19250Help
Entry
Maq22A_c19250     CDS       T04311                                 

Gene name
mcl
Definition
(GenBank) malyl-CoA lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00630  Glyoxylate and dicarboxylate metabolism
maqu00660  C5-Branched dibasic acid metabolism
maqu00680  Methane metabolism
maqu01100  Metabolic pathways
maqu01120  Microbial metabolism in diverse environments
maqu01200  Carbon metabolism
Module
maqu_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Maq22A_c19250 (mcl)
   00660 C5-Branched dibasic acid metabolism
    Maq22A_c19250 (mcl)
  09102 Energy metabolism
   00680 Methane metabolism
    Maq22A_c19250 (mcl)
Enzymes [BR:maqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Maq22A_c19250 (mcl)
    4.1.3.25  (S)-citramalyl-CoA lyase
     Maq22A_c19250 (mcl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: BAQ46921
UniProt: A0A0C6F2S4
Position
complement(3733046..3734020)
Genome map
AA seq 324 aa AA seqDB search
MSFTLVQQATPRLHRSELAVPGSNPTFMEKSAKSSADVIFLDLEDAVAPDDKEQARKNIV
QALNEIDWGSKTMMIRINGLDTHYMYRDVVDIVESCPRLDMILIPKVGVPQDVYAIDVLV
TQIEQAKRREKKLGFEVLIETALGMANVEAIAQSSKRLEAMSFGVADYAASLRARSTVIG
GVNPDYSVLTDKDEAGARQTHWQDPWLFAQNRMLVACRAYGLRPIDGPFGDFSDPDGYTS
AARRCAALGFEGKWAIHPSQIDLANEVFTPSEAEVTKARRILSAMEEAAKAGRGAVSLDG
RLIDIASIRMAEALIGKADAMARA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaccctcgtccagcaagccacaccccgcctgcaccgctccgagctggcggtg
ccgggctcgaacccgaccttcatggagaaatcggccaagtcctcggccgacgtgatcttc
ctcgacctcgaggatgcggtcgcgcccgacgacaaggagcaggcgcgcaagaacatcgtc
caggccctcaacgaaatcgattggggatcgaagacgatgatgatccgcatcaacggcctc
gacacccactacatgtaccgcgacgtggtcgacatcgtggagtcctgcccgcgcctcgac
atgatcctgatccccaaggtcggcgtgccgcaggacgtctacgccatcgacgtgctggtg
acgcagatcgagcaagccaagcgccgcgagaagaagctcggcttcgaggtgctgatcgag
acggcgctcggcatggccaacgtcgaggccatcgcccagtcctcgaagcgcctcgaggcg
atgtcgttcggcgtcgccgactacgccgcctcgctgcgcgcccgctcgacggtgatcggc
ggcgtcaacccggactactcggtgctgaccgacaaggacgaggcgggcgcccgccagacc
cactggcaggatccgtggctgtttgcccagaaccggatgctggtggcctgccgcgcctac
ggtctgcgcccgatcgacggcccgttcggcgacttctcggacccggacggctacacctcg
gcggcccggcgctgcgcggcgctcggcttcgagggcaagtgggcgatccacccctcgcag
atcgatctggccaacgaggtcttcaccccgagcgaggccgaggtgaccaaggcgcgccgc
atcctctcggcgatggaggaggcggccaaggccggccgcggcgccgtctcgctggacggg
cgcctcatcgacatcgcgtcgatccgcatggccgaggcgctgatcggcaaggccgacgcc
atggcgcgggcctga

DBGET integrated database retrieval system