KEGG   Methylobacterium aquaticum: Maq22A_c20030Help
Entry
Maq22A_c20030     CDS       T04311                                 

Gene name
ftfL
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00670  One carbon pool by folate
maqu01100  Metabolic pathways
maqu01120  Microbial metabolism in diverse environments
maqu01200  Carbon metabolism
Module
maqu_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Maq22A_c20030 (ftfL)
Enzymes [BR:maqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Maq22A_c20030 (ftfL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: BAQ47058
UniProt: A0A0C6FEN4
Position
complement(3885935..3887611)
Genome map
AA seq 558 aa AA seqDB search
MPTDIEIARAATLQPITAIAERIGIPEDALHPYGRHIAKVDHAHIRSLEARPEGKLILVT
AISPTPAGEGKTTTTVGLGDALNRIGRKTVICLREPSLGPCFGMKGGAAGGGKAQVVPME
AINLHFTGDFHAITSAHSLAAALIDNHVYWGNALDIDLRRVAFRRVLDMNDRALRTITQS
LGGVANGFPREDGFDITVASEVMAVFCLARDLADLEARLGRIVVAETRDRKAVTLADLKA
TGAMTVLLKDALQPNLVQTLEGSPALIHGGPFANIAHGCNSVIATRAGLKLGDYVVTEAG
FGADLGAEKFFDIKCRQAGLSPSAVVIVATVRALKMHGGVAKSDLGRENVEALERGFANL
ARHVENVRRFGAPVVVAVNHFHADTEAEHAALKALCRDRLDVEAITCRHWAEGGAGAEAL
AHAVTALADSGPAAAPRFAYPDAMPLEAKIRTVAQTLYGAADIQVESKAAAKLAAFEQAG
HGHLPVCMAKTQYSFSTDPTLMGAPSGHVVAVRDARLSAGAGFVVAICGEIMTMPGLPKV
PAAEGIHLDAEGRIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgacatcgagatcgcccgcgcggccaccctccagccgatcaccgccatcgcg
gagcgcatcggcatccccgaggacgcactccacccgtacggtcggcacatcgccaaggtc
gaccacgcccatatccgcagcctcgaggcgcggcccgagggcaagctgatcctggtgacg
gcgatcagcccgacgccggcgggcgagggcaagaccaccaccacggtaggactcggcgac
gcgctcaaccggatcggccgcaagacggtgatctgcctgcgcgagccctcgctcggcccg
tgcttcggcatgaagggcggcgcggccggcggcggcaaggcccaggtggtgccgatggag
gcgatcaacctccacttcaccggcgacttccacgccatcacctcggcccacagcctcgcc
gcggcgctgatcgacaaccacgtctactggggcaacgccctcgacatcgacctgcgccgg
gtggcgttccgccgcgtcctcgacatgaacgaccgggcgctgcgcaccatcacccagagc
ctcggcggcgtcgccaacggcttcccgcgggaggacggcttcgacatcaccgtcgcctcc
gaggtgatggcggtgttctgcctcgcccgcgacctcgccgacctcgaggcgcgcctcggc
cggatcgtggtggcggagacccgcgaccgaaaggccgtgacgctggccgacctcaaggcc
accggcgccatgacggtgctgctcaaggacgcgctccagcccaacctcgtccagaccctg
gagggcagcccggccctgatccatggcgggcccttcgccaacatcgcccacggctgcaac
tcggtgatcgcgacccgggccggcctcaagctcggcgactacgtggtgaccgaggccggc
ttcggggccgatctcggggcggaaaagttcttcgacatcaagtgccgccaggccggcctc
agcccgtcggccgtcgtcatcgtggcgacggtgcgggccctcaagatgcatggaggcgtc
gccaagtccgatctcggccgcgagaacgtcgaggccctggagcggggctttgccaacctc
gcccgccacgtcgagaacgtgcgccgtttcggcgcgcccgtggtggtggcggtcaatcac
ttccacgccgacaccgaggccgagcacgcggcgctcaaggcgctctgccgcgaccggctc
gacgtcgaggcgatcacctgccggcactgggccgagggcggcgccggcgccgaggcgctg
gcccacgcggtgacggccctggccgattccggcccggccgcggcgccgcgcttcgcctac
ccggacgcgatgccgctggaggccaagatccgcaccgtcgcccagaccctctacggcgcc
gccgacatccaggtggaatcgaaggcggccgccaagctcgcggccttcgagcaggccggc
cacggccacctgccggtctgcatggccaagacccagtactcgttctccaccgacccgacc
ctgatgggcgcgcccagcggccacgtcgtggcggtgcgcgacgcccgcctctcggccggg
gccggcttcgttgtggcgatctgcggggagatcatgacgatgcccggcctgcccaaggtg
ccggcggcggaaggcatccatctcgacgccgaggggcggatcgaggggctgttctaa

DBGET integrated database retrieval system